KEGG   Homo sapiens (human): 3479Help
Entry
3479              CDS       T01001                                 

Gene name
IGF1, IGF, IGF-I, IGFI, MGF
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04114  Oocyte meiosis
hsa04115  p53 signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04510  Focal adhesion
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04960  Aldosterone-regulated sodium reabsorption
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Network
N00133  EWSR1-FLI1 fusion to transcriptional activation
N00135  EWSR1-ERG fusion to transcriptional activation
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
Disease
H00015  Malignant pleural mesothelioma
H02040  Insulin-like growth factor I deficiency
Drug target
Masoprocol: D04862
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    3479 (IGF1)
   04015 Rap1 signaling pathway
    3479 (IGF1)
   04010 MAPK signaling pathway
    3479 (IGF1)
   04066 HIF-1 signaling pathway
    3479 (IGF1)
   04068 FoxO signaling pathway
    3479 (IGF1)
   04151 PI3K-Akt signaling pathway
    3479 (IGF1)
   04152 AMPK signaling pathway
    3479 (IGF1)
   04150 mTOR signaling pathway
    3479 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    3479 (IGF1)
   04115 p53 signaling pathway
    3479 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3479 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    3479 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    3479 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    3479 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3479 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    3479 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3479 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    3479 (IGF1)
   04213 Longevity regulating pathway - multiple species
    3479 (IGF1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3479 (IGF1)
   05202 Transcriptional misregulation in cancer
    3479 (IGF1)
   05205 Proteoglycans in cancer
    3479 (IGF1)
  09162 Cancers: Specific types
   05214 Glioma
    3479 (IGF1)
   05218 Melanoma
    3479 (IGF1)
   05215 Prostate cancer
    3479 (IGF1)
   05224 Breast cancer
    3479 (IGF1)
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    3479 (IGF1)
   05414 Dilated cardiomyopathy (DCM)
    3479 (IGF1)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3479 (IGF1)
   01522 Endocrine resistance
    3479 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3479 (IGF1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   3479 (IGF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Insulin DUF2865
Motif
Other DBs
NCBI-GeneID: 3479
NCBI-ProteinID: NP_001104755
OMIM: 147440
HGNC: 5464
Ensembl: ENSG00000017427
Vega: OTTHUMG00000149910
Pharos: P05019(Tbio)
UniProt: P05019
Structure
PDB: 

Position
12q23.2
AA seq 195 aa AA seqDB search
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRR
EIGSRNAECRGKKGK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcgctgtgcctgctc
accttcaccagctctgccacggctggaccggagacgctctgcggggctgagctggtggat
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc
tccagcagtcggagggcgcctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctaaggaggctggagatgtattgcgcacccctcaagcctgccaagtcagctcgctct
gtccgtgcccagcgccacaccgacatgcccaagacccagaagtatcagcccccatctacc
aacaagaacacgaagtctcagagaaggaaaggttggccaaagacacatccaggaggggaa
cagaaggaggggacagaagcaagtctgcagatcagaggaaagaagaaagagcagaggagg
gagattggaagtagaaatgctgaatgcagaggcaaaaaaggaaaatga

DBGET integrated database retrieval system