KEGG   Homo sapiens (human): 347902Help
Entry
347902            CDS       T01001                                 

Gene name
AMIGO2, ALI1, AMIGO-2, DEGA
Definition
(RefSeq) adhesion molecule with Ig like domain 2
  KO
K22529  amphoterin-induced protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    347902 (AMIGO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 ig Ig_3 LRR_9 I-set Ig_2 V-set Ig_6 LRRNT
Motif
Other DBs
NCBI-GeneID: 347902
NCBI-ProteinID: NP_001137140
OMIM: 615690
HGNC: 24073
Ensembl: ENSG00000139211
Vega: OTTHUMG00000169616
Pharos: Q86SJ2(Tbio)
UniProt: Q86SJ2 A0A024R127
Position
12q13.11
AA seq 522 aa AA seqDB search
MSLRVHTLPTLLGAVVRPGCRELLCLLMITVTVGPGASGVCPTACICATDIVSCTNKNLS
KVPGNLFRLIKRLDLSYNRIGLLDSEWIPVSFAKLNTLILRHNNITSISTGSFSTTPNLK
CLDLSSNKLKTVKNAVFQELKVLEVLLLYNNHISYLDPSAFGGLSQLQKLYLSGNFLTQF
PMDLYVGRFKLAELMFLDVSYNRIPSMPMHHINLVPGKQLRGIYLHGNPFVCDCSLYSLL
VFWYRRHFSSVMDFKNDYTCRLWSDSRHSRQVLLLQDSFMNCSDSIINGSFRALGFIHEA
QVGERLMVHCDSKTGNANTDFIWVGPDNRLLEPDKEMENFYVFHNGSLVIESPRFEDAGV
YSCIAMNKQRLLNETVDVTINVSNFTVSRSHAHEAFNTAFTTLAACVASIVLVLLYLYLT
PCPCKCKTKRQKNMLHQSNAHSSILSPGPASDASADERKAGAGKRVVFLEPLKDTAAGQN
GKVRLFPSEAVIAEGILKSTRGKSDSDSVNSVFSDTPFVAST
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttacgtgtacacactctgcccaccctgcttggagccgtcgtcagaccgggctgc
agggagctgctgtgtttgctgatgatcacagtgactgtgggccctggtgcctctggggtg
tgccccaccgcttgcatctgtgccactgacatcgtcagctgcaccaacaaaaacctgtcc
aaggtgcctgggaaccttttcagactgattaagagactggacctgagttataacagaatt
gggcttctggattctgagtggattccagtatcgtttgcaaagctgaacaccctaattctt
cgtcataacaacatcaccagcatttccacgggcagtttttccacaactccaaatttgaag
tgtcttgacttatcgtccaataagctgaagacggtgaaaaatgctgtattccaagagttg
aaggttctggaagtgcttctgctttacaacaatcacatatcctatctcgatccttcagcg
tttggagggctctcccagttgcagaaactctacttaagtggaaattttctcacacagttt
ccgatggatttgtatgttggaaggttcaagctggcagaactgatgtttttagatgtttct
tataaccgaattccttccatgccaatgcaccacataaatttagtgccaggaaaacagctg
agaggcatctaccttcatggaaacccatttgtctgtgactgttccctgtactccttgctg
gtcttttggtatcgtaggcactttagctcagtgatggattttaagaacgattacacctgt
cgcctgtggtctgactccaggcactcgcgtcaggtacttctgctccaggatagctttatg
aattgctctgacagcatcatcaatggttcctttcgtgcgcttggctttattcatgaggct
caggtcggggaaagactgatggtccactgtgacagcaagacaggtaatgcaaatacggat
ttcatctgggtgggtccagataacagactgctagagccggataaagagatggaaaacttt
tacgtgtttcacaatggaagtctggttatagaaagccctcgttttgaggatgctggagtg
tattcttgtatcgcaatgaataagcaacgcctgttaaatgaaactgtggacgtcacaata
aatgtgagcaatttcactgtaagcagatcccatgctcatgaggcatttaacacagctttt
accactcttgctgcttgcgtggccagtatcgttttggtacttttgtacctctatctgact
ccatgcccctgcaagtgtaaaaccaagagacagaaaaatatgctacaccaaagcaatgcc
cattcatcgattctcagtcctggccccgctagtgatgcctccgctgatgaacggaaggca
ggtgcaggtaaaagagtggtgtttttggaacccctgaaggatactgcagcagggcagaac
gggaaagtcaggctctttcccagcgaggcagtgatagctgagggcatcctaaagtccacg
agggggaaatctgactcagattcagtcaattcagtgttttctgacacaccttttgtggcg
tccacttaa

DBGET integrated database retrieval system