KEGG   Homo sapiens (human): 3484Help
Entry
3484              CDS       T01001                                 

Gene name
IGFBP1, AFBP, IBP1, IGF-BP25, PP12, hIGFBP-1
Definition
(RefSeq) insulin like growth factor binding protein 1
  KO
K23578  insulin-like growth factor-binding protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3484 (IGFBP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    3484 (IGFBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 IGFBP
Motif
Other DBs
NCBI-GeneID: 3484
NCBI-ProteinID: NP_000587
OMIM: 146730
HGNC: 5469
Ensembl: ENSG00000146678
Vega: OTTHUMG00000152343
Pharos: P08833(Tchem)
UniProt: P08833
Structure
PDB: 

Position
7p12.3
AA seq 259 aa AA seqDB search
MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCC
PMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGS
PESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIEL
YRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP
GSPEIRGDPNCQIYFNVQN
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaggtccccgttgctcgcgtctggctggtactgctcctgctgactgtccaggtc
ggcgtgacagccggcgctccgtggcagtgcgcgccctgctccgccgagaagctcgcgctc
tgcccgccggtgtccgcctcgtgctcggaggtcacccggtccgccggctgcggctgttgc
ccgatgtgcgccctgcctctgggcgccgcgtgcggcgtggcgactgcacgctgcgcccgg
ggactcagttgccgcgcgctgccgggggagcagcaacctctgcacgccctcacccgcggc
caaggcgcctgcgtgcaggagtctgacgcctccgctccccatgctgcagaggcagggagc
cctgaaagcccagagagcacggagataactgaggaggagctcctggataatttccatctg
atggccccttctgaagaggatcattccatcctttgggacgccatcagtacctatgatggc
tcgaaggctctccatgtcaccaacatcaaaaaatggaaggagccctgccgaatagaactc
tacagagtcgtagagagtttagccaaggcacaggagacatcaggagaagaaatttccaaa
ttttacctgccaaactgcaacaagaatggattttatcacagcagacagtgtgagacatcc
atggatggagaggcgggactctgctggtgcgtctacccttggaatgggaagaggatccct
gggtctccagagatcaggggagaccccaactgccagatatattttaatgtacaaaactga

DBGET integrated database retrieval system