KEGG   Homo sapiens (human): 3486Help
Entry
3486              CDS       T01001                                 

Gene name
IGFBP3, BP-53, IBP3
Definition
(RefSeq) insulin like growth factor binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04218  Cellular senescence
hsa05202  Transcriptional misregulation in cancer
Network
N00134  EWSR1-FLI1 fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04115 p53 signaling pathway
    3486 (IGFBP3)
   04218 Cellular senescence
    3486 (IGFBP3)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    3486 (IGFBP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   3486 (IGFBP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 IGFBP
Motif
Other DBs
NCBI-GeneID: 3486
NCBI-ProteinID: NP_000589
OMIM: 146732
HGNC: 5472
Ensembl: ENSG00000146674
Vega: OTTHUMG00000023769
Pharos: P17936(Tchem)
UniProt: P17936 B3KPF0
Position
7p12.3
AA seq 291 aa AA seqDB search
MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgggcgcgacccacgctctgggccgctgcgctgactctgctggtgctgctccgc
gggccgccggtggcgcgggctggcgcgagctcggcgggcttgggtcccgtggtgcgctgc
gagccgtgcgacgcgcgtgcactggcccagtgcgcgcctccgcccgccgtgtgcgcggag
ctggtgcgcgagccgggctgcggctgctgcctgacgtgcgcactgagcgagggccagccg
tgcggcatctacaccgagcgctgtggctccggccttcgctgccagccgtcgcccgacgag
gcgcgaccgctgcaggcgctgctggacggccgcgggctctgcgtcaacgctagtgccgtc
agccgcctgcgcgcctacctgctgccagcgccgccagctccaggaaatgctagtgagtcg
gaggaagaccgcagcgccggcagtgtggagagcccgtccgtctccagcacgcaccgggtg
tctgatcccaagttccaccccctccattcaaagataatcatcatcaagaaagggcatgct
aaagacagccagcgctacaaagttgactacgagtctcagagcacagatacccagaacttc
tcctccgagtccaagcgggagacagaatatggtccctgccgtagagaaatggaagacaca
ctgaatcacctgaagttcctcaatgtgctgagtcccaggggtgtacacattcccaactgt
gacaagaagggattttataagaaaaagcagtgtcgcccttccaaaggcaggaagcggggc
ttctgctggtgtgtggataagtatgggcagcctctcccaggctacaccaccaaggggaag
gaggacgtgcactgctacagcatgcagagcaagtag

DBGET integrated database retrieval system