KEGG   Homo sapiens (human): 3487
Entry
3487              CDS       T01001                                 

Gene name
IGFBP4, BP-4, HT29-IGFBP, IBP4, IGFBP-4
Definition
(RefSeq) insulin like growth factor binding protein 4
  KO
K23576  insulin-like growth factor-binding protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3487 (IGFBP4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    3487 (IGFBP4)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 3487
NCBI-ProteinID: NP_001543
OMIM: 146733
HGNC: 5473
Ensembl: ENSG00000141753
Vega: OTTHUMG00000133326
Pharos: P22692(Tchem)
UniProt: P22692 A0A024R1U8
Structure
PDB: 
1WQJ 2DSR 2DSP 2DSQ

Position
17q21.2
AA seq 258 aa
MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCA
LGLGMPCGVYTPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDE
GDHPNNSFSPCSAHDRRCLQKHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHR
ALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCVDRKTGVKLPGG
LEPKGELDCHQLADSFRE
NT seq 777 nt   +upstreamnt  +downstreamnt
atgctgcccctctgcctcgtggccgccctgctgctggccgccgggcccgggccgagcctg
ggcgacgaagccatccactgcccgccctgctccgaggagaagctggcgcgctgccgcccc
cccgtgggctgcgaggagctggtgcgagagccgggctgcggctgttgcgccacttgcgcc
ctgggcttggggatgccctgcggggtgtacaccccccgttgcggctcgggcctgcgctgc
tacccgccccgaggggtggagaagcccctgcacacactgatgcacgggcaaggcgtgtgc
atggagctggcggagatcgaggccatccaggaaagcctgcagccctctgacaaggacgag
ggtgaccaccccaacaacagcttcagcccctgtagcgcccatgaccgcaggtgcctgcag
aagcacttcgccaaaattcgagaccggagcaccagtgggggcaagatgaaggtcaatggg
gcgccccgggaggatgcccggcctgtgccccagggctcctgccagagcgagctgcaccgg
gcgctggagcggctggccgcttcacagagccgcacccacgaggacctctacatcatcccc
atccccaactgcgaccgcaacggcaacttccaccccaagcagtgtcacccagctctggat
gggcagcgtggcaagtgctggtgtgtggaccggaagacgggggtgaagcttccggggggc
ctggagccaaagggggagctggactgccaccagctggctgacagctttcgagagtga

DBGET integrated database retrieval system