KEGG   Homo sapiens (human): 3488Help
Entry
3488              CDS       T01001                                 

Gene name
IGFBP5, IBP5
Definition
(RefSeq) insulin like growth factor binding protein 5
  KO
K23577  insulin-like growth factor-binding protein 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3488 (IGFBP5)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    3488 (IGFBP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 IGFBP
Motif
Other DBs
NCBI-GeneID: 3488
NCBI-ProteinID: NP_000590
OMIM: 146734
HGNC: 5474
Ensembl: ENSG00000115461
Vega: OTTHUMG00000133058
Pharos: P24593(Tchem)
UniProt: P24593
Structure
PDB: 

Position
2q35
AA seq 272 aa AA seqDB search
MVLLTAVLLLLAAYAGPAQSLGSFVHCEPCDEKALSMCPPSPLGCELVKEPGCGCCMTCA
LAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKSYREQVKIERDSREHE
EPTTSEMAEETYSPKIFRPKHTRISELKAEAVKKDRRKKLTQSKFVGGAENTAHPRIISA
PEMRQESEQGPCRRHMEASLQELKASPRMVPRAVYLPNCDRKGFYKRKQCKPSRGRKRGI
CWCVDKYGMKLPGMEYVDGDFQCHTFDSSNVE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgctcaccgcggtcctcctgctgctggccgcctatgcggggccggcccagagc
ctgggctccttcgtgcactgcgagccctgcgacgagaaagccctctccatgtgccccccc
agccccctgggctgcgagctggtcaaggagccgggctgcggctgctgcatgacctgcgcc
ctggccgaggggcagtcgtgcggcgtctacaccgagcgctgcgcccaggggctgcgctgc
ctcccccggcaggacgaggagaagccgctgcacgccctgctgcacggccgcggggtttgc
ctcaacgaaaagagctaccgcgagcaagtcaagatcgagagagactcccgtgagcacgag
gagcccaccacctctgagatggccgaggagacctactcccccaagatcttccggcccaaa
cacacccgcatctccgagctgaaggctgaagcagtgaagaaggaccgcagaaagaagctg
acccagtccaagtttgtcgggggagccgagaacactgcccacccccggatcatctctgca
cctgagatgagacaggagtctgagcagggcccctgccgcagacacatggaggcttccctg
caggagctcaaagccagcccacgcatggtgccccgtgctgtgtacctgcccaattgtgac
cgcaaaggattctacaagagaaagcagtgcaaaccttcccgtggccgcaaacgtggcatc
tgctggtgcgtggacaagtacgggatgaagctgccaggcatggagtacgttgacggggac
tttcagtgccacaccttcgacagcagcaacgttgagtga

DBGET integrated database retrieval system