KEGG   Homo sapiens (human): 3489Help
Entry
3489              CDS       T01001                                 

Gene name
IGFBP6, IBP6
Definition
(RefSeq) insulin like growth factor binding protein 6
  KO
K23579  insulin-like growth factor-binding protein 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3489 (IGFBP6)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    3489 (IGFBP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 IGFBP
Motif
Other DBs
NCBI-GeneID: 3489
NCBI-ProteinID: NP_002169
OMIM: 146735
HGNC: 5475
Ensembl: ENSG00000167779
Vega: OTTHUMG00000169773
Pharos: P24592(Tchem)
UniProt: P24592
Structure
PDB: 

Position
12q13.13
AA seq 240 aa AA seqDB search
MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEA
EGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKES
KPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYR
GAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaccccccacaggctgctgccaccgctgctgctgctgctagctctgctgctcgctgcc
agcccaggaggcgccttggcgcggtgcccaggctgcgggcaaggggtgcaggcgggttgt
ccagggggctgcgtggaggaggaggatggggggtcgccagccgagggctgcgcggaagct
gagggctgtctcaggagggaggggcaggagtgcggggtctacacccctaactgcgcccca
ggactgcagtgccatccgcccaaggacgacgaggcgcctttgcgggcgctgctgctcggc
cgaggccgctgccttccggcccgcgcgcctgctgttgcagaggagaatcctaaggagagt
aaaccccaagcaggcactgcccgcccacaggatgtgaaccgcagagaccaacagaggaat
ccaggcacctctaccacgccctcccagcccaattctgcgggtgtccaagacactgagatg
ggcccatgccgtagacatctggactcagtgctgcagcaactccagactgaggtctaccga
ggggctcaaacactctacgtgcccaattgtgaccatcgaggcttctaccggaagcggcag
tgccgctcctcccaggggcagcgccgaggtccctgctggtgtgtggatcggatgggcaag
tccctgccagggtctccagatggcaatggaagctcctcctgccccactgggagtagcggc
taa

DBGET integrated database retrieval system