KEGG   Homo sapiens (human): 348932Help
Entry
348932            CDS       T01001                                 

Gene name
SLC6A18, Xtrp2
Definition
(RefSeq) solute carrier family 6 member 18
  KO
K05048  solute carrier family 6 (neurotransmitter transporter, amino acid/orphan) member 15/16/17/18/20
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    348932 (SLC6A18)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   348932 (SLC6A18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNF
Motif
Other DBs
NCBI-GeneID: 348932
NCBI-ProteinID: NP_872438
OMIM: 610300
HGNC: 26441
Ensembl: ENSG00000164363
Vega: OTTHUMG00000090356
Pharos: Q96N87(Tbio)
UniProt: Q96N87
Position
5p15.33
AA seq 628 aa AA seqDB search
MAHAPEPDPAACDLGDERPKWDNKAQYLLSCTGFAVGLGNIWRFPYLCQTYGGGAFLIPY
VIALVFEGIPIFHVELAIGQRLRKGSVGVWTAISPYLSGVGLGCVTLSFLISLYYNTIVA
WVLWYLLNSFQHPLPWSSCPPDLNRTGFVEECQGSSAVSYFWYRQTLNITADINDSGSIQ
WWLLICLAASWAVVYMCVIRGIETTGKVIYFTALFPYLVLTIFLIRGLTLPGATKGLIYL
FTPNMHILQNPRVWLDAATQIFFSLSLAFGGHIAFASYNSPRNDCQKDAVVIALVNRMTS
LYASIAVFSVLGFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKR
VAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAPVWAMLFFGMLFTLGLSTMFG
TVEAVITPLLDVGVLPRWVPKEALTGLVCLVCFLSATCFTLQSGNYWLEIFDNFAASPNL
LMLAFLEVVGVVYVYGMKRFCDDIAWMTGRRPSPYWRLTWRVVSPLLLTIFVAYIILLFW
KPLRYKAWNPKYELFPSRQEKLYPGWARAACVLLSLLPVLWVPVAALAQLLTRRRRTWRD
RDARPDTDMRPDTDTRPDTDMRPDTDMR
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggctcatgccccagaaccggacccggccgcctgcgacctcggggatgagaggcccaag
tgggacaacaaggcccagtacctcctgagctgcactgggtttgccgtgggactggggaac
atttggcggttcccatacctgtgccagacctatggaggaggggccttcctcatcccctac
gtcatcgcgctggtcttcgaggggatccccattttccacgtcgagctcgccatcggccag
cggctgcggaagggcagcgtcggcgtgtggacggccatctccccgtacctcagtggagta
gggctgggctgtgtcacgctgtccttcctgatcagcctgtactacaacaccatcgtggcg
tgggtgctgtggtacctcctcaactccttccagcacccgctgccctggagctcctgccca
ccggacctcaacagaacagggtttgtggaggagtgccagggcagcagcgccgtgagctac
ttctggtaccggcagacactgaacatcacagccgacatcaatgacagtggctccatccag
tggtggctgctcatctgcttggcagcctcctgggcagtcgtgtacatgtgtgtcatcagg
ggcattgagactacagggaaggtgatttacttcacagctttgttcccttacctggtcctg
accatctttctcatcagagggctgaccctgccaggggcaacaaaaggactcatctacttg
ttcactcccaacatgcacattctccagaacccccgggtgtggctggacgcagccacccag
atattcttctctctgtccctggccttcggaggacacatcgcttttgcaagttacaactcg
cccaggaatgactgccagaaggatgcggtggtcatcgccctggtcaacaggatgacctcc
ctgtacgcgtccatcgctgtcttctctgtcctggggttcaaagcaactaatgactacgag
cactgcctggacagaaacatcctcagcctcatcaacgactttgacttcccagagcagagc
atctccagggacgactacccagccgtcctcatgcacctgaacgccacctggcccaagagg
gtggcccagctccccctgaaggcctgcctcctggaagactttctggataagagtgcctcg
ggcccgggcctggccttcgtcgtcttcacggagaccgacctccacatgccgggggctcct
gtgtgggccatgctcttcttcgggatgctgttcaccttggggctatcgaccatgttcggg
accgtggaggcggtcatcacacccctgctggacgtgggggtcctgcctagatgggtcccc
aaggaggccctgactgggctggtctgcctggtctgcttcctctccgccacctgcttcacg
ctgcagtctgggaactactggctggagattttcgacaattttgccgcttccccgaacctg
ctcatgttggcctttctcgaggttgtgggtgtcgtttatgtttatggaatgaaacggttc
tgcgatgacattgcgtggatgaccgggaggcggcccagcccctactggcggctgacctgg
agggtggtcagtcccctgctgctgaccatctttgtggcttacatcatcctcctgttctgg
aagccactgagatacaaggcctggaaccccaaatacgagctgttcccctcgcgtcaggag
aagctctacccgggctgggcgcgcgccgcctgtgtgctgctgtccttgctgcccgtgctg
tgggtcccggtggccgcgcttgctcagctgctcacccggcggaggcggacgtggagggac
agggacgcgcgcccagacacggacatgcgcccggacacggacacgcgcccagacacggac
atgcgcccggacacggacatgcgctga

DBGET integrated database retrieval system