KEGG   Homo sapiens (human): 348995
Entry
348995            CDS       T01001                                 
Symbol
NUP43, bA350J20.1, p42
Name
(RefSeq) nucleoporin 43
  KO
K14305  nuclear pore complex protein Nup43
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  Nucleocytoplasmic transport
hsa05014  Amyotrophic lateral sclerosis
Network
nt06464  Amyotrophic lateral sclerosis
  Element
N01152  Nuclear export of mRNA
N01153  Mutation-caused aberrant GLE1 to nuclear export of mRNA
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    348995 (NUP43)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    348995 (NUP43)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    348995 (NUP43)
   03036 Chromosome and associated proteins [BR:hsa03036]
    348995 (NUP43)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     348995 (NUP43)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Spindle formation proteins
    348995 (NUP43)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 348995
NCBI-ProteinID: NP_942590
OMIM: 608141
HGNC: 21182
Ensembl: ENSG00000120253
UniProt: Q8NFH3 Q8TEA6
Position
6:complement(149724315..149749358)
AA seq 380 aa
MEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGG
FEGDHQLLCDIRHHGDVMDLQFFDQERIVAASSTGCVTVFLHHPNNQTLSVNQQWTTAHY
HTGPGSPSYSSAPCTGVVCNNPEIVTVGEDGRINLFRADHKEAVRTIDNADSSTLHAVTF
LRTPEILTVNSIGQLKIWDFRQQGNEPSQILSLTGDRVPLHCVDRHPNQQHVVATGGQDG
MLSIWDVRQGTMPVSLLKAHEAEMWEVHFHPSNPEHLFTCSEDGSLWHWDASTDVPEKSS
LFHQGGRSSTFLSHSISNQANVHQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLG
PCLVCGTDAEAIYVTRHLFS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggaggaaatttatgcgaagtttgtgtcccagaaaatcagcaaaacccgctggcgaccg
ctgcctccgggaagtttacagaccgcggagacgttcgctacaggatcttgggacaatgag
gaaaattatatttcactgtggtctattggagattttggaaacttggactctgatggaggg
tttgaaggagaccatcagttattgtgtgatatcagacaccatggtgatgtaatggattta
cagttttttgaccaggaaagaattgtcgctgcttcatcaacaggatgtgtaacagttttc
cttcaccatccaaataaccagactctgtcagtcaaccagcagtggactacagctcactac
cacacaggccctggcagtccttcctatagcagtgcaccatgtacaggtgttgtgtgcaac
aacccagaaatcgttacagttggagaggatggtcgaataaatctcttcagagctgatcac
aaggaagctgtaagaaccatagacaatgcagatagtagtacactccatgctgtaaccttt
cttcgaactcctgagattcttactgtaaattcaattggacagttgaaaatatgggatttc
agacaacaaggaaatgagccttctcagatattgtcactgactggtgaccgagtgccactc
cactgtgttgatagacatcccaaccaacagcatgttgtagctactggtggccaagatgga
atgttgagtatttgggatgttagacaaggtactatgcctgtatctctgctgaaggctcat
gaagctgaaatgtgggaagttcactttcacccatccaacccagaacatctttttacctgc
tctgaagatggatccctctggcactgggatgcttccacagatgtacctgaaaagtcgtca
ctctttcaccaaggaggaagaagcagtacttttttgtctcatagcattagtaaccaagct
aatgttcaccagtctgtcattagctcctggctcagcactgatcctgcaaaagaccgaatt
gaaatcacaagcttacttcccagtaggtctctgtctgtgaacactttggatgttttaggt
ccttgtcttgtttgtggaaccgatgcagaagcaatttatgttactagacatcttttttcg
tag

DBGET integrated database retrieval system