KEGG   Homo sapiens (human): 349149Help
Entry
349149            CDS       T01001                                 

Gene name
GJC3, CX29, CX30.2, CX31.3, GJE1
Definition
(RefSeq) gap junction protein gamma 3
  KO
K07628  gap junction gamma-3 protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    349149 (GJC3)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   349149 (GJC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Connexin
Motif
Other DBs
NCBI-GeneID: 349149
NCBI-ProteinID: NP_853516
OMIM: 611925
HGNC: 17495
Ensembl: ENSG00000176402
Vega: OTTHUMG00000156649
Pharos: Q8NFK1(Tbio)
UniProt: Q8NFK1
Position
7q22.1
AA seq 279 aa AA seqDB search
MCGRFLRRLLAEESRRSTPVGRLLLPVLLGFRLVLLAASGPGVYGDEQSEFVCHTQQPGC
KAACFDAFHPLSPLRFWVFQVILVAVPSALYMGFTLYHVIWHWELSGKGKEEETLIQGRE
GNTDVPGAGSLRLLWAYVAQLGARLVLEGAALGLQYHLYGFQMPSSFACRREPCLGSITC
NLSRPSEKTIFLKTMFGVSGFCLLFTFLELVLLGLGRWWRTWKHKSSSSKYFLTSESTRR
HKKATDSLPVVETKEQFQEAVPGRSLAQEKQRPVGPRDA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcaggttcctgcggcggctgctggcggaggagagccggcgctccacccccgtg
gggcgcctcttgcttcccgtgctcctgggattccgccttgtgctgctggctgccagtggg
cctggagtctatggtgatgagcagagtgaattcgtgtgtcacacccagcagccgggctgc
aaggctgcctgcttcgatgccttccaccccctctccccgctgcgtttctgggtcttccag
gtcatcttggtggctgtacccagcgccctctatatgggtttcactctgtatcacgtgatc
tggcactgggaattatcaggaaaggggaaggaggaggagaccctgatccagggacgggag
ggcaacacagatgtcccaggggctggaagcctcaggctgctctgggcttatgtggctcag
ctgggggctcggcttgtcctggagggggcagccctggggttgcagtaccacctgtatggg
ttccagatgcccagctcctttgcatgtcgccgagaaccttgccttggtagtataacctgc
aatctgtcccgcccctctgagaagaccattttcctaaagaccatgtttggagtcagcggt
ttctgtctcttgtttacttttttggagcttgtgcttctgggtttggggagatggtggagg
acctggaagcacaaatcttcctcttctaaatacttcctaacttcagagagcaccagaaga
cacaagaaagcaaccgatagcctcccagtggtggaaaccaaagagcaatttcaagaagca
gttccaggaagaagcttagcccaggaaaaacaaagaccagttggacccagagatgcctga

DBGET integrated database retrieval system