KEGG   Homo sapiens (human): 349565Help
Entry
349565            CDS       T01001                                 

Gene name
NMNAT3, FKSG76, PNAT-3, PNAT3
Definition
(RefSeq) nicotinamide nucleotide adenylyltransferase 3
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    349565 (NMNAT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     349565 (NMNAT3)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     349565 (NMNAT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 349565
NCBI-ProteinID: NP_001307440
OMIM: 608702
HGNC: 20989
Ensembl: ENSG00000163864
Vega: OTTHUMG00000159951
Pharos: Q96T66(Tbio)
UniProt: Q96T66 Q49AL4
Structure
PDB: 

Position
3q23
AA seq 252 aa AA seqDB search
MKSRIPVVLLACGSFNPITNMHLRMFEVARDHLHQTGMYQVIQGIISPVNDTYGKKDLAA
SHHRVAMARLALQTSDWIRVDPWESEQAQWMETVKVLRHHHSKLLRSPPQMEGPDHGKAL
FSTPAAVPELKLLCGADVLKTFQTPNLWKDAHIQEIVEKFGLVCVGRVGHDPKGYIAESP
ILRMHQHNIHLAKEPVQNEISATYIRRALGQGQSVKYLIPDAVITYIKDHGLYTKGSTWK
GKSTQSTEGKTS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaagagccgaatacctgtggtgctcctggcctgtggctcctttaaccccatcaccaac
atgcacctgcgcatgtttgaggtggccagagatcacctacaccaaacaggaatgtaccag
gtcatccagggtatcatctctcctgtcaacgacacctatgggaagaaagacctcgcagct
tctcatcaccgagtggccatggcccggctggccctgcagacatccgactggatccgggtg
gacccttgggagagtgagcaggcacagtggatggagacagtgaaggtgctgaggcatcat
cacagcaaactgctcagatctccaccccagatggaaggcccagaccatggcaaggcactc
ttctcgacccctgcagctgtgcctgagctgaagcttctctgtggggcagacgtcttgaag
accttccagacccccaacctctggaaggatgcgcacatccaggaaatagtggagaagttt
ggcttggtgtgcgtgggccgagtaggtcacgacccaaaaggttacatcgcagaatctccc
atcctacggatgcaccagcacaacattcacctggccaaggagcctgtgcagaatgagatc
agtgccacatacatcaggcgagccttgggccaagggcagagcgtaaagtacctgattccc
gatgctgtcatcacgtacatcaaggaccatggcctctacaccaagggcagtacctggaaa
ggcaaaagcacccagagcactgagggcaagacaagctag

DBGET integrated database retrieval system