KEGG   Homo sapiens (human): 350383Help
Entry
350383            CDS       T01001                                 

Gene name
GPR142, GPRg1b, PGR2
Definition
(RefSeq) G protein-coupled receptor 142
  KO
K08430  G protein-coupled receptor 142
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    350383 (GPR142)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   L-Tryptophan and L-Phenylalanine
    350383 (GPR142)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srx Srg
Motif
Other DBs
NCBI-GeneID: 350383
NCBI-ProteinID: NP_861455
OMIM: 609046
HGNC: 20088
Ensembl: ENSG00000257008
Vega: OTTHUMG00000178581
Pharos: Q7Z601(Tchem)
UniProt: Q7Z601
Position
17q25.1
AA seq 462 aa AA seqDB search
MSIMMLPMEQKIQWVPTSLQDITAVLGTEAYTEEDKSMVSHAQKSQHSCLSHSRWLRSPQ
VTGGSWDLRIRPSKDSSSFRQAQCLRKDPGANNHLESQGVRGTAGDADRELRGPSEKATA
GQPRVTLLPTPHVSGLSQEFESHWPEIAERSPCVAGVIPVIYYSVLLGLGLPVSLLTAVA
LARLATRTRRPSYYYLLALTASDIIIQVVIVFAGFLLQGAVLARQVPQAVVRTANILEFA
ANHASVWIAILLTVDRYTALCHPLHHRAASSPGRTRRAIAAVLSAALLTGIPFYWWLDMW
RDTDSPRTLDEVLKWAHCLTVYFIPCGVFLVTNSAIIHRLRRRGRSGLQPRVGKSTAILL
GITTLFTLLWAPRVFVMLYHMYVAPVHRDWRVHLALDVANMVAMLHTAANFGLYCFVSKT
FRATVRQVIHDAYLPCTLASQPEGMAAKPVMEPPGLPTGAEV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagtattatgatgttgcccatggagcaaaagatccagtgggtccccacttccctgcag
gacatcactgctgtcctgggtacagaagcatatactgaggaagacaaatcaatggtgtcc
catgcacagaaaagccagcattcttgtctcagccattccaggtggctgaggtctccacag
gtcacagggggaagctgggacctccgaataaggccatccaaggactccagcagtttccgc
caggctcagtgtctgcgtaaggatcctggggcaaacaaccacttggagagccaaggggtg
agaggtacagctggcgatgctgacagggagctgcggggaccctcagaaaaagccacagct
ggccagccacgagtgaccctgctgcccacgccccacgtcagcgggctgagccaggagttt
gaaagccactggccagagatcgcagagaggtccccgtgtgtggctggcgtcatccctgtc
atctactacagtgtcctgctgggcttggggctgcctgtcagcctcctgaccgcagtggcc
ctggcgcgccttgccaccaggaccaggaggccctcctactactaccttctggcgctcaca
gcctcggatatcatcatccaggtggtcatcgtgttcgcgggcttcctcctgcagggagca
gtgctggcccgccaggtgccccaggctgtggtgcgcacggccaacatcctggagtttgct
gccaaccacgcctcagtctggatcgccatcctgctcacggttgaccgctacactgccctg
tgccaccccctgcaccatcgggccgcctcgtccccaggccggacccgccgggccattgct
gctgtcctgagtgctgccctgttgaccggcatccccttctactggtggctggacatgtgg
agagacaccgactcacccagaacactggacgaggtcctcaagtgggctcactgtctcact
gtctatttcatcccttgtggcgtgttcctggtcaccaactcggccatcatccaccggcta
cggaggaggggccggagtgggctgcagccccgggtgggcaagagcacagccatcctcctg
ggcatcaccacactgttcaccctcctgtgggcgccccgggtcttcgtcatgctctaccac
atgtacgtggcccctgtccaccgggactggagggtccacctggccttggatgtggccaat
atggtggccatgctccacacggcagccaacttcggcctctactgctttgtcagcaagact
ttccgggccactgtccgacaggtcatccacgatgcctacctgccctgcactttggcatca
cagccagagggcatggcggcgaagcctgtgatggagcctccgggactccccacaggggca
gaagtgtag

DBGET integrated database retrieval system