KEGG   Homo sapiens (human): 351Help
Entry
351               CDS       T01001                                 

Gene name
APP, AAA, ABETA, ABPP, AD1, APPI, CTFgamma, CVAP, PN-II, PN2, preA4
Definition
(RefSeq) amyloid beta precursor protein
  KO
K04520  amyloid beta A4 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa05010  Alzheimer disease
Disease
H00056  Alzheimer disease (AD)
H01185  Cerebral amyloid angiopathy (CAA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    351 (APP)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    351 (APP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    351 (APP)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    351 (APP)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Others
   351 (APP)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Others
   351 (APP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: APP_E2 APP_N Beta-APP APP_amyloid APP_Cu_bd Kunitz_BPTI
Motif
Other DBs
NCBI-GeneID: 351
NCBI-ProteinID: NP_000475
OMIM: 104760
HGNC: 620
Ensembl: ENSG00000142192
Vega: OTTHUMG00000078438
Pharos: P05067(Tchem)
UniProt: P05067 A0A140VJC8
Structure
PDB: 

Position
21q21.3
AA seq 770 aa AA seqDB search
MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
IKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccggtttggcactgctcctgctggccgcctggacggctcgggcgctggaggta
cccactgatggtaatgctggcctgctggctgaaccccagattgccatgttctgtggcaga
ctgaacatgcacatgaatgtccagaatgggaagtgggattcagatccatcagggaccaaa
acctgcattgataccaaggaaggcatcctgcagtattgccaagaagtctaccctgaactg
cagatcaccaatgtggtagaagccaaccaaccagtgaccatccagaactggtgcaagcgg
ggccgcaagcagtgcaagacccatccccactttgtgattccctaccgctgcttagttggt
gagtttgtaagtgatgcccttctcgttcctgacaagtgcaaattcttacaccaggagagg
atggatgtttgcgaaactcatcttcactggcacaccgtcgccaaagagacatgcagtgag
aagagtaccaacttgcatgactacggcatgttgctgccctgcggaattgacaagttccga
ggggtagagtttgtgtgttgcccactggctgaagaaagtgacaatgtggattctgctgat
gcggaggaggatgactcggatgtctggtggggcggagcagacacagactatgcagatggg
agtgaagacaaagtagtagaagtagcagaggaggaagaagtggctgaggtggaagaagaa
gaagccgatgatgacgaggacgatgaggatggtgatgaggtagaggaagaggctgaggaa
ccctacgaagaagccacagagagaaccaccagcattgccaccaccaccaccaccaccaca
gagtctgtggaagaggtggttcgagaggtgtgctctgaacaagccgagacggggccgtgc
cgagcaatgatctcccgctggtactttgatgtgactgaagggaagtgtgccccattcttt
tacggcggatgtggcggcaaccggaacaactttgacacagaagagtactgcatggccgtg
tgtggcagcgccatgtcccaaagtttactcaagactacccaggaacctcttgcccgagat
cctgttaaacttcctacaacagcagccagtacccctgatgccgttgacaagtatctcgag
acacctggggatgagaatgaacatgcccatttccagaaagccaaagagaggcttgaggcc
aagcaccgagagagaatgtcccaggtcatgagagaatgggaagaggcagaacgtcaagca
aagaacttgcctaaagctgataagaaggcagttatccagcatttccaggagaaagtggaa
tctttggaacaggaagcagccaacgagagacagcagctggtggagacacacatggccaga
gtggaagccatgctcaatgaccgccgccgcctggccctggagaactacatcaccgctctg
caggctgttcctcctcggcctcgtcacgtgttcaatatgctaaagaagtatgtccgcgca
gaacagaaggacagacagcacaccctaaagcatttcgagcatgtgcgcatggtggatccc
aagaaagccgctcagatccggtcccaggttatgacacacctccgtgtgatttatgagcgc
atgaatcagtctctctccctgctctacaacgtgcctgcagtggccgaggagattcaggat
gaagttgatgagctgcttcagaaagagcaaaactattcagatgacgtcttggccaacatg
attagtgaaccaaggatcagttacggaaacgatgctctcatgccatctttgaccgaaacg
aaaaccaccgtggagctccttcccgtgaatggagagttcagcctggacgatctccagccg
tggcattcttttggggctgactctgtgccagccaacacagaaaacgaagttgagcctgtt
gatgcccgccctgctgccgaccgaggactgaccactcgaccaggttctgggttgacaaat
atcaagacggaggagatctctgaagtgaagatggatgcagaattccgacatgactcagga
tatgaagttcatcatcaaaaattggtgttctttgcagaagatgtgggttcaaacaaaggt
gcaatcattggactcatggtgggcggtgttgtcatagcgacagtgatcgtcatcaccttg
gtgatgctgaagaagaaacagtacacatccattcatcatggtgtggtggaggttgacgcc
gctgtcaccccagaggagcgccacctgtccaagatgcagcagaacggctacgaaaatcca
acctacaagttctttgagcagatgcagaactag

DBGET integrated database retrieval system