KEGG   Homo sapiens (human): 3516Help
Entry
3516              CDS       T01001                                 

Gene name
RBPJ, AOS3, CBF1, IGKJRB, IGKJRB1, KBF2, RBP-J, RBPJK, RBPSUH, SUH, csl
Definition
(RefSeq) recombination signal binding protein for immunoglobulin kappa J region
  KO
K06053  recombining binding protein suppressor of hairless
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Module
hsa_M00682  Notch signaling
Network
N00224  EBV EBNALP binding to host-cell-protein
N00225  EBV EBNA2 binding to host-cell-protein
N00226  EBV EBNA3A/3B to host-cell-protein inhibition
N00262  EBV EBNA3C to host-cell-protein inhibition
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Disease
H01413  Adams-Oliver syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3516 (RBPJ)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3516 (RBPJ)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    3516 (RBPJ)
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    3516 (RBPJ)
   05165 Human papillomavirus infection
    3516 (RBPJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3516 (RBPJ)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   Others
    3516 (RBPJ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BTD LAG1-DNAbind TIG RHD_dimer
Motif
Other DBs
NCBI-GeneID: 3516
NCBI-ProteinID: NP_005340
OMIM: 147183
HGNC: 5724
Ensembl: ENSG00000168214
Vega: OTTHUMG00000097793
Pharos: Q06330(Tbio)
UniProt: Q06330
Structure
PDB: 

Position
4p15.2
AA seq 500 aa AA seqDB search
MDHTEGSPAEEPPAHAPSPGKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSY
GNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGK
NYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLC
IASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDG
YIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCL
SQERIIQFQATPCPKEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESL
QLNGGGDVAMLELTGQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQ
PVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGS
YTNASTNSTSVTSSTATVVS
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggaccacacggagggctcgcccgcggaggagccgcctgcgcatgctccatcgcctggg
aaatttggtgagcggcctccacctaaacgacttactagggaagctatgcgaaattattta
aaagagcgaggggatcaaacagtacttattcttcatgcaaaagttgcacagaagtcatat
ggaaatgaaaaaaggtttttttgcccacctccttgtgtatatcttatgggcagtggatgg
aagaaaaaaaaagaacaaatggaacgcgatggttgttctgaacaagagtctcaaccgtgt
gcatttattgggataggaaatagtgaccaagaaatgcagcagctaaacttggaaggaaag
aactattgcacagccaaaacattgtatatatctgactcagacaagcgaaagcacttcatg
ttgtctgtaaagatgttctatggcaacagtgatgacattggtgtgttcctcagcaagcgg
ataaaagtcatctccaaaccttccaaaaagaagcagtcattgaaaaatgctgacttatgc
attgcctcaggaacaaaggtggctctgtttaatcgactacgatcccagacagttagtacc
agatacttgcatgtagaaggaggtaattttcatgccagttcacagcagtggggagccttt
tttattcatctcttggatgatgatgaatcagaaggagaagaattcacagtccgagatggc
tacatccattatggacaaacagtcaaacttgtgtgctcagttactggcatggcactccca
agattgataattaggaaagttgataagcagaccgcattattggatgcagatgatcctgtg
tcacaactccataaatgtgcattttaccttaaggatacagaaagaatgtatttgtgcctt
tctcaagaaagaataattcaatttcaggccactccatgtccaaaagaaccaaataaagag
atgataaatgatggcgcttcctggacaatcattagcacagataaggcagagtatacattt
tatgagggaatgggccctgtccttgccccagtcactcctgtgcctgtggtagagagcctt
cagttgaatggcggtggggacgtagcaatgcttgaacttacaggacagaatttcactcca
aatttacgagtgtggtttggggatgtagaagctgaaactatgtacaggtgtggagagagt
atgctctgtgtcgtcccagacatttctgcattccgagaaggttggagatgggtccggcaa
ccagtccaggttccagtaactttggtccgaaatgatggaatcatttattccaccagcctt
acctttacctacacaccagaaccagggccgcggccacattgcagtgcagcaggagcaatc
cttcgagccaattcaagccaggtgccccctaacgaatcaaacacaaacagcgagggaagt
tacacaaacgccagcacaaattcaaccagtgtcacatcatctacagccacagtggtatcc
taa

DBGET integrated database retrieval system