KEGG   Homo sapiens (human): 353137Help
Entry
353137            CDS       T01001                                 

Gene name
LCE1F, LEP6
Definition
(RefSeq) late cornified envelope 1F
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LCE
Motif
Other DBs
NCBI-GeneID: 353137
NCBI-ProteinID: NP_848131
OMIM: 612608
HGNC: 29467
Ensembl: ENSG00000240386
Vega: OTTHUMG00000012403
Pharos: Q5T754(Tdark)
UniProt: Q5T754
Position
1q21.3
AA seq 118 aa AA seqDB search
MSCQQSQQQCQPPPKCTPKCPPKCPTPKCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGCC
SSGGGGCCSSGGGGCCLSHHRRRRSHRHRPQSSDCCSQPSAGSSCCGGGSGQHSGGCC
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgccagcagagccagcagcagtgccagccccctcccaagtgcactcccaagtgc
cctcccaagtgccccacaccgaagtgccccccaaagtgtccccctaagtgccctcctgtc
tcttcctgctgcagcgtcagctccggaggctgctgtggctccagctctgggggctgctgc
agctctgggggtggtggctgctgcagctctgggggaggcggctgttgcctgagccaccac
agacggcgtaggtcccaccgccacagaccccagagctctgactgctgcagccagccctca
gcgggctccagctgctgcggagggggcagtggccagcactctggaggctgctgctga

DBGET integrated database retrieval system