KEGG   Homo sapiens (human): 353140Help
Entry
353140            CDS       T01001                                 

Gene name
LCE2C, LEP11
Definition
(RefSeq) late cornified envelope 2C
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LCE
Motif
Other DBs
NCBI-GeneID: 353140
NCBI-ProteinID: NP_848516
OMIM: 612611
HGNC: 29460
Ensembl: ENSG00000187180
Vega: OTTHUMG00000012389
Pharos: Q5TA81(Tdark)
UniProt: Q5TA81
Position
1q21.3
AA seq 110 aa AA seqDB search
MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCPPQCPAPCFPAVSSCCGPSSGSCCGPSS
GGCCSSGAGGCSLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgccagcaaaaccagcagcagtgccagccccctcccaagtgtcctcccaagtgt
accccaaaatgtccacctaagtgtccccccaaatgcccaccacagtgcccagctccatgt
ttccctgcagtctcttcttgctgtggtcccagctctgggagctgctgtggtcccagctct
gggggctgctgcagctctggggctggtggctgctccctgagccaccacaggccccgtctc
ttccaccggcgccggcaccagagccccgactgctgtgagagtgaaccttctgggggctct
ggctgctgccacagctctgggggctgctgctga

DBGET integrated database retrieval system