KEGG   Homo sapiens (human): 353144Help
Entry
353144            CDS       T01001                                 

Gene name
LCE3C, LEP15, SPRL3A
Definition
(RefSeq) late cornified envelope 3C
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LCE
Motif
Other DBs
NCBI-GeneID: 353144
NCBI-ProteinID: NP_848521
OMIM: 612615
HGNC: 16612
Ensembl: ENSG00000244057
Vega: OTTHUMG00000014403
Pharos: Q5T5A8(Tbio)
UniProt: Q5T5A8
Position
1q21.3
AA seq 94 aa AA seqDB search
MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHF
RSHQCRRQRSNSCDRGSGQQGGGSCRGHGSGGCC
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgtcctgccagcaaaaccagcagcagtgccagccccctcccagttgtccctcacccaag
tgtcccccaaagagcccagcacagtgtctgcctccaccctcttctgactgtgctctaagc
tccgggggctgtggccccagttctgaaagtggctgctgcctgagccaccacaggcacttc
aggtcccatcaatgccggcgccagagatccaactcctgtgacaggggcagtggtcagcaa
ggcgggggctcctgccgtggccatggctctgggggctgctgctga

DBGET integrated database retrieval system