KEGG   Homo sapiens (human): 353322
Entry
353322            CDS       T01001                                 
Symbol
ANKRD37, Lrp2bp
Name
(RefSeq) ankyrin repeat domain 37
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank
Other DBs
NCBI-GeneID: 353322
NCBI-ProteinID: NP_859077
OMIM: 619021
HGNC: 29593
Ensembl: ENSG00000186352
Pharos: Q7Z713(Tdark)
UniProt: Q7Z713
Position
4:185396841..185400723
AA seq 158 aa
MLLLDCNPEVDGLKHLLETGASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQ
DVLGEAPLHKAAKVGSLECLSLLVASDAQIDLCNKNGQTAEDLAWSCGFPDCAKFLTTIK
CMQTIKASEHPDRNDCVAVLRQKRSLGSVENTSGKRKC
NT seq 477 nt   +upstreamnt  +downstreamnt
atgctgttgctggattgcaaccccgaggtggatggtctgaagcatttgctggagacaggg
gcctcggtcaacgcacccccggatccctgcaagcagtcgcctgtccacttagccgcagga
agcggccttgcttgctttcttctctggcagctgcaaacgggcgctgacctcaaccagcag
gatgttttaggagaagctccactacacaaggcagcaaaagttggaagcctggagtgccta
agcctgcttgtagccagtgatgcccaaattgatttatgtaataagaacgggcaaacagct
gaagatctcgcttggtcatgtggatttccagactgtgccaagtttcttacaacaattaaa
tgtatgcagacaataaaagcaagtgaacaccctgacaggaatgattgtgttgccgtgctc
agacagaaacggagtctcggaagtgtagaaaataccagtgggaaaaggaagtgctga

DBGET integrated database retrieval system