KEGG   Homo sapiens (human): 353333Help
Entry
353333            CDS       T01001                                 

Gene name
KRTAP10-10, KAP10.10, KAP18.10, KRTAP18-10, KRTAP18.10
Definition
(RefSeq) keratin associated protein 10-10
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Keratin_B2_2 Keratin_B2
Motif
Other DBs
NCBI-GeneID: 353333
NCBI-ProteinID: NP_859016
HGNC: 22972
Ensembl: ENSG00000221859
Vega: OTTHUMG00000057631
Pharos: P60014(Tdark)
UniProt: P60014
Position
21q22.3
AA seq 251 aa AA seqDB search
MAASTMSICSSACTDSWRVVDCPESCCEPCCCAPAPSLTLVCTPVSCVSSPCCQTACEPS
ACQSGYTSSCTTPCYQQSSCQPDCCTSSPCQQACCVPVCCVPVCCVPVCNKPVCFVPTCS
ESSPSCCQQSSCQPTCCTSSPCQQACCVPVCSKSVCYVPVCSGASTSCCQQSSCQPACCT
ASCCRPSSSVSLLCHPVCKSTCCVPVPSCGASASSCQPSCCRTASCVSLLCRPVCSRPAC
YSLCSGQKSSC
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctccaccatgtccatctgctccagcgcctgcactgactcttggcgggtagtc
gactgcccagagagctgctgcgagccctgctgctgtgccccagcccccagcttgaccctg
gtctgcaccccagtgagctgtgtgtccagcccctgctgccagacggcctgtgagcccagc
gcctgccaatcaggctacaccagctcctgcacaaccccatgctaccagcagtctagctgc
cagccggattgctgcacctcctccccctgccagcaggcctgctgtgtgcctgtctgctgt
gtgcccgtctgctgcgtgcccgtctgtaacaagcctgtgtgcttcgtgcctacctgctcc
gagtcttccccttcatgctgccagcagtctagctgccagccaacttgctgcacctcctcc
ccatgccagcaggcctgctgtgtgcctgtctgctctaagtccgtctgctatgtgcctgtg
tgctctggggcttccacttcatgctgccagcagtctagctgccagcctgcttgctgcacc
gcctcctgctgcagaccctcctcctccgtgtccctcctctgccaccctgtgtgcaagtcc
acctgctgcgtgcccgtcccctcctgcggtgcctctgcctcctcctgccagcccagctgc
tgccgcacggcctcctgtgtttccctcctctgccgccccgtgtgctcccgccctgcctgc
tacagcctctgctctggccagaagtccagctgctga

DBGET integrated database retrieval system