KEGG   Homo sapiens (human): 353500Help
Entry
353500            CDS       T01001                                 

Gene name
BMP8A, OP-2
Definition
(RefSeq) bone morphogenetic protein 8a
  KO
K16622  bone morphogenetic protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    353500 (BMP8A)
   04390 Hippo signaling pathway
    353500 (BMP8A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    353500 (BMP8A)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    353500 (BMP8A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    353500 (BMP8A)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   353500 (BMP8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 353500
NCBI-ProteinID: NP_861525
HGNC: 21650
Ensembl: ENSG00000183682
Vega: OTTHUMG00000008394
Pharos: Q7Z5Y6(Tbio)
UniProt: Q7Z5Y6
Position
1p34.3
AA seq 402 aa AA seqDB search
MAARPGPLWLLGLTLCALGGGGPGLRPPPGCPQRRLGARERRDVQREILAVLGLPGRPRP
RAPPAASRLPASAPLFMLDLYHAMAGDDDEDGAPAEQRLGRADLVMSFVNMVERDRALGH
QEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLF
FLDLQTLRAGDEGWLVLDVTAASDCWLLKRHKDLGLRLYVETEDGHSVDPGLAGLLGQRA
PRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVRGSHGRQV
CRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPN
AVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgcgccccggaccgctctggcttctgggcctgacgttgtgcgcgctgggcggg
ggcggccccggcctgcgacccccgcccggctgtccccagcgacgtctgggcgcgcgcgag
cgccgggacgtgcagcgcgagatcctggcggtgctcgggctacccgggcggccccggccc
cgcgcgccacccgccgcctcccggctgcccgcgtccgcgccgctcttcatgctggacctg
taccacgccatggctggcgacgacgacgaggacggcgcgcccgcggagcagcgcctgggc
cgcgccgacctggtcatgagcttcgtcaacatggtggagcgagaccgtgccctgggccac
caggagccccattggaaggagttccgctttgacctgacccagatcccggctggggaggcg
gtcacagctgcggagttccggatttacaaggtgcccagcatccacctgctcaacaggacc
ctccacgtcagcatgttccaggtggtccaggagcagtccaacagggagtctgacttgttc
tttttggatcttcagacgctccgagctggagacgagggctggctggtgctggatgtcaca
gcagccagtgactgctggttgctgaagcgtcacaaggacctgggactccgcctctatgtg
gagactgaggacgggcacagcgtggatcctggcctggccggcctgctgggtcaacgggcc
ccacgctcccaacagcctttcgtggtcactttcttcagggccagtccgagtcccatccgc
acccctcgggcagtgaggccactgaggaggaggcaaccgaagaaaagcaacgagctgccg
caggccaaccgactcccagggatctttgatgacgtccgcggctcccacggccggcaggtc
tgccgtcggcacgagctctacgtcagcttccaggaccttggctggctggactgggtcatc
gccccccaaggctactcagcctattactgtgagggggagtgctccttcccgctggactcc
tgcatgaacgccaccaaccacgccatcctgcagtccctggtgcacctgatgaagccaaac
gcagtccccaaggcgtgctgtgcacccaccaagctgagcgccacctctgtgctctactat
gacagcagcaacaacgtcatcctgcgcaagcaccgcaacatggtggtcaaggcctgcggc
tgccactga

KEGG   Homo sapiens (human): 656Help
Entry
656               CDS       T01001                                 

Gene name
BMP8B, BMP8, OP2
Definition
(RefSeq) bone morphogenetic protein 8b
  KO
K16622  bone morphogenetic protein 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04714  Thermogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    656 (BMP8B)
   04390 Hippo signaling pathway
    656 (BMP8B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    656 (BMP8B)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    656 (BMP8B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    656 (BMP8B)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   656 (BMP8B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 656
NCBI-ProteinID: NP_001711
OMIM: 602284
HGNC: 1075
Ensembl: ENSG00000116985
Vega: OTTHUMG00000009247
Pharos: P34820(Tbio)
UniProt: P34820
Position
1p34.2
AA seq 402 aa AA seqDB search
MTALPGPLWLLGLALCALGGGGPGLRPPPGCPQRRLGARERRDVQREILAVLGLPGRPRP
RAPPAASRLPASAPLFMLDLYHAMAGDDDEDGAPAERRLGRADLVMSFVNMVERDRALGH
QEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLF
FLDLQTLRAGDEGWLVLDVTAASDCWLLKRHKDLGLRLYVETEDGHSVDPGLAGLLGQRA
PRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQV
CRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPD
AVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgctccccggcccgctctggctcctgggcctggcgctatgcgcgctgggcggg
ggcggccccggcctgcgacccccgcccggctgtccccagcgacgtctgggcgcgcgcgag
cgccgggacgtgcagcgcgagatcctggcggtgctcgggctgcctgggcggccccggccc
cgcgcgccacccgccgcctcccggctgcccgcgtccgcgccgctcttcatgctggacctg
taccacgccatggccggcgacgacgacgaggacggcgcgcccgcggagcggcgcctgggc
cgcgccgacctggtcatgagcttcgttaacatggtggagcgagaccgtgccctgggccac
caggagccccattggaaggagttccgctttgacctgacccagatcccggctggggaggcg
gtcacagctgcggagttccggatttacaaggtgcccagcatccacctgctcaacaggacc
ctccacgtcagcatgttccaggtggtccaggagcagtccaacagggagtctgacttgttc
tttttggatcttcagacgctccgagctggagacgagggctggctggtgctggatgtcaca
gcagccagtgactgctggttgctgaagcgtcacaaggacctgggactccgcctctatgtg
gagactgaggacgggcacagcgtggatcctggcctggccggcctgctgggtcaacgggcc
ccacgctcccaacagcctttcgtggtcactttcttcagggccagtccgagtcccatccgc
acccctcgggcagtgaggccactgaggaggaggcagccgaagaaaagcaacgagctgccg
caggccaaccgactcccagggatctttgatgacgtccacggctcccacggccggcaggtc
tgccgtcggcacgagctctacgtcagcttccaggacctcggctggctggactgggtcatc
gctccccaaggctactcggcctattactgtgagggggagtgctccttcccactggactcc
tgcatgaatgccaccaaccacgccatcctgcagtccctggtgcacctgatgatgccagac
gcagtccccaaggcgtgctgtgcacccaccaagctgagcgccacctctgtgctctactat
gacagcagcaacaatgtcatcctgcgcaagcaccgcaacatggtggtcaaggcctgcggc
tgccactga

DBGET integrated database retrieval system