KEGG   Homo sapiens (human): 353515Help
Entry
353515            CDS       T01001                                 

Gene name
XKRY2, XKRYP7
Definition
(RefSeq) XK related, Y-linked 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: XK-related
Motif
Other DBs
NCBI-GeneID: 353515
NCBI-ProteinID: NP_001002906
HGNC: 23922
Ensembl: ENSG00000244646
UniProt: A2RUG3
Position
Yq11.222
AA seq 117 aa AA seqDB search
MFIFNSIADDIFPLISCVGAIHCNILAIRTGNDFAAIKLQVIKLIYLMIWHSLVIISPVV
TLAFFPASLKQGSLHFLLIIYFVLLLTPWLEFSKSGTHLPSNTKNNSSMVGKYGCLS
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgtttatctttaatagcattgctgatgacatattccctcttatcagttgtgtaggtgcc
attcactgcaatatactggccatccgcactggcaacgactttgctgccattaagctacag
gtgataaaattgatctatctcatgatatggcattcgttggtgattatctcacctgtagtg
actctggcattcttccctgcatctctgaaacaggggagcttacactttctattaatcata
tattttgtattattgttgacaccatggctggagttttcgaaaagtggaactcatcttcct
agcaacacaaaaaataattccagcatggtgggtaagtatggatgcttatcttaa

DBGET integrated database retrieval system