KEGG   Homo sapiens (human): 354Help
Entry
354               CDS       T01001                                 

Gene name
KLK3, APS, KLK2A1, PSA, hK3
Definition
(RefSeq) kallikrein related peptidase 3
  KO
K01351  semenogelase [EC:3.4.21.77]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05215  Prostate cancer
Network
N00083  Androgen receptor signaling pathway
N00084  Amplified AR to androgen receptor signaling pathway
N00085  Mutation-activated AR to androgen receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05200 Pathways in cancer
    354 (KLK3)
   05215 Prostate cancer
    354 (KLK3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.77  semenogelase
     354 (KLK3)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   354 (KLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 AXH
Motif
Other DBs
NCBI-GeneID: 354
NCBI-ProteinID: NP_001639
OMIM: 176820
HGNC: 6364
Ensembl: ENSG00000142515
Vega: OTTHUMG00000182867
Pharos: P07288(Tchem)
UniProt: P07288 Q546G3
Structure
PDB: 

Position
19q13.33
AA seq 261 aa AA seqDB search
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD
LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS
NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP
SLYTKVVHYRKWIKDTIVANP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtcccggttgtcttcctcaccctgtccgtgacgtggattggtgctgcacccctc
atcctgtctcggattgtgggaggctgggagtgcgagaagcattcccaaccctggcaggtg
cttgtggcctctcgtggcagggcagtctgcggcggtgttctggtgcacccccagtgggtc
ctcacagctgcccactgcatcaggaacaaaagcgtgatcttgctgggtcggcacagcctg
tttcatcctgaagacacaggccaggtatttcaggtcagccacagcttcccacacccgctc
tacgatatgagcctcctgaagaatcgattcctcaggccaggtgatgactccagccacgac
ctcatgctgctccgcctgtcagagcctgccgagctcacggatgctgtgaaggtcatggac
ctgcccacccaggagccagcactggggaccacctgctacgcctcaggctggggcagcatt
gaaccagaggagttcttgaccccaaagaaacttcagtgtgtggacctccatgttatttcc
aatgacgtgtgtgcgcaagttcaccctcagaaggtgaccaagttcatgctgtgtgctgga
cgctggacagggggcaaaagcacctgctcgggtgattctgggggcccacttgtctgtaat
ggtgtgcttcaaggtatcacgtcatggggcagtgaaccatgtgccctgcccgaaaggcct
tccctgtacaccaaggtggtgcattaccggaagtggatcaaggacaccatcgtggccaac
ccctga

DBGET integrated database retrieval system