KEGG   Homo sapiens (human): 3549
Entry
3549              CDS       T01001                                 

Symbol
IHH, BDA1, HHG2
Name
(RefSeq) Indian hedgehog signaling molecule
  KO
K11989  indian hedgehog
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa05205  Proteoglycans in cancer
Disease
H00482  Brachydactyly
H00675  Acrocapitofemoral dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    3549 (IHH)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    3549 (IHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3549 (IHH)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   3549 (IHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 3549
NCBI-ProteinID: NP_002172
OMIM: 600726
HGNC: 5956
Ensembl: ENSG00000163501
Vega: OTTHUMG00000154631
Pharos: Q14623(Tbio)
UniProt: Q14623
Structure
PDB: 

Position
2q35
AA seq 411 aa
MSPARLRPRLHFCLVLLLLLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKT
LGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMN
QWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYY
ESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGSPTF
SDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQP
GQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTKHGTLVVEDVVASCFAAVADHHLAQLA
FWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtctcccgcccggctccggccccgactgcacttctgcctggtcctgttgctgctgctg
gtggtgccggcggcatggggctgcgggccgggtcgggtggtgggcagccgccggcgaccg
ccacgcaaactcgtgccgctcgcctacaagcagttcagccccaatgtgcccgagaagacc
ctgggcgccagcggacgctatgaaggcaagatcgctcgcagctccgagcgcttcaaggag
ctcacccccaattacaatccagacatcatcttcaaggacgaggagaacacaggcgccgac
cgcctcatgacccagcgctgcaaggaccgcctgaactcgctggctatctcggtgatgaac
cagtggcccggtgtgaagctgcgggtgaccgagggctgggacgaggacggccaccactca
gaggagtccctgcattatgagggccgcgcggtggacatcaccacatcagaccgcgaccgc
aataagtatggactgctggcgcgcttggcagtggaggccggctttgactgggtgtattac
gagtcaaaggcccacgtgcattgctccgtcaagtccgagcactcggccgcagccaagacg
ggcggctgcttccctgccggagcccaggtacgcctggagagtggggcgcgtgtggccttg
tcagccgtgaggccgggagaccgtgtgctggccatgggggaggatgggagccccaccttc
agcgatgtgctcattttcctggaccgcgagcctcacaggctgagagccttccaggtcatc
gagactcaggaccccccacgccgcctggcactcacacccgctcacctgctctttacggct
gacaatcacacggagccggcagcccgcttccgggccacatttgccagccacgtgcagcct
ggccagtacgtgctggtggctggggtgccaggcctgcagcctgcccgcgtggcagctgtc
tctacacacgtggccctcggggcctacgccccgctcacaaagcatgggacactggtggtg
gaggatgtggtggcatcctgcttcgcggccgtggctgaccaccacctggctcagttggcc
ttctggcccctgagactctttcacagcttggcatggggcagctggactccgggggagggt
gtgcattggtacccccagctgctctaccgcctggggcgtctcctgctagaagagggcagc
ttccacccactgggcatgtccggggcagggagctga

KEGG   Homo sapiens (human): 50846
Entry
50846             CDS       T01001                                 

Symbol
DHH, GDMN, GDXYM, HHG-3, SRXY7
Name
(RefSeq) desert hedgehog signaling molecule
  KO
K11990  desert hedgehog
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
Disease
H00607  46,XY gonadal dysgenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    50846 (DHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    50846 (DHH)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   50846 (DHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 50846
NCBI-ProteinID: NP_066382
OMIM: 605423
HGNC: 2865
Ensembl: ENSG00000139549
Vega: OTTHUMG00000170408
Pharos: O43323(Tbio)
UniProt: O43323
Structure
PDB: 
2WFQ 3N1G 2WFR 2WG3 3N1Q

Position
12q13.12
AA seq 396 aa
MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGAS
GPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPG
VRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRN
HVHVSVKADNSLAVRAGGCFPGNATVRLWSGERKGLRELHRGDWVLAADASGRVVPTPVL
LFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSV
LAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRAFAPL
RLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELLG
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggctctcctgaccaatctactgcccctgtgctgcttggcacttctggcgctgccagcc
cagagctgcgggccgggccgggggccggttggccggcgccgctatgcgcgcaagcagctc
gtgccgctactctacaagcaatttgtgcccggcgtgccagagcggaccctgggcgccagt
gggccagcggaggggagggtggcaaggggctccgagcgcttccgggacctcgtgcccaac
tacaaccccgacatcatcttcaaggatgaggagaacagtggagccgaccgcctgatgacc
gagcgttgtaaggagcgggtgaacgctttggccattgccgtgatgaacatgtggcccgga
gtgcgcctacgagtgactgagggctgggacgaggacggccaccacgctcaggattcactc
cactacgaaggccgtgctttggacatcactacgtctgaccgcgaccgcaacaagtatggg
ttgctggcgcgcctcgcagtggaagccggcttcgactgggtctactacgagtcccgcaac
cacgtccacgtgtcggtcaaagctgataactcactggcggtccgggcgggcggctgcttt
ccgggaaatgcaactgtgcgcctgtggagcggcgagcggaaagggctgcgggaactgcac
cgcggagactgggttttggcggccgatgcgtcaggccgggtggtgcccacgccggtgctg
ctcttcctggaccgggacttgcagcgccgggcttcatttgtggctgtggagaccgagtgg
cctccacgcaaactgttgctcacgccctggcacctggtgtttgccgctcgagggccggcg
cccgcgccaggcgactttgcaccggtgttcgcgcgccggctacgcgctggggactcggtg
ctggcgcccggcggggatgcgcttcggccagcgcgcgtggcccgtgtggcgcgggaggaa
gccgtgggcgtgttcgcgccgctcaccgcgcacgggacgctgctggtgaacgatgtcctg
gcctcttgctacgcggttctggagagtcaccagtgggcgcaccgcgcttttgcccccttg
agactgctgcacgcgctaggggcgctgctccccggcggggccgtccagccgactggcatg
cattggtactctcggctcctctaccgcttagcggaggagctactgggctga

KEGG   Homo sapiens (human): 6469
Entry
6469              CDS       T01001                                 

Symbol
SHH, HHG1, HLP3, HPE3, MCOPCB5, SMMCI, ShhNC, TPT, TPTPS
Name
(RefSeq) sonic hedgehog signaling molecule
  KO
K11988  sonic hedgehog
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04360  Axon guidance
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05226  Gastric cancer
Network
nt06217  HH signaling
nt06240  Transcription
nt06261  Gastric cancer
nt06269  Basal cell carcinoma
  Element
N00062  Hedgehog signaling pathway
N00251  CDX2-overexpression to transcriptional repression
Disease
H00039  Basal cell carcinoma
H00267  Holoprosencephaly
H00652  Solitary median maxillary central incisor syndrome
H01027  Microphthalmia
H01160  Schizencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    6469 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    6469 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6469 (SHH)
   05205 Proteoglycans in cancer
    6469 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    6469 (SHH)
   05217 Basal cell carcinoma
    6469 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    6469 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6469 (SHH)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   6469 (SHH)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   6469 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Other DBs
NCBI-GeneID: 6469
NCBI-ProteinID: NP_000184
OMIM: 600725
HGNC: 10848
Ensembl: ENSG00000164690
Vega: OTTHUMG00000151349
Pharos: Q15465(Tchem)
UniProt: Q15465
Structure
PDB: 

Position
7q36.3
AA seq 462 aa
MLLLARCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLSPGDRVLAADDQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSATGEPEASSGSGPPSGGALG
PRALFASRVRPGQRVYVVAERDGDRRLLPAAVHSVTLSEEAAGAYAPLTAQGTILINRVL
ASCYAVIEEHSWAHRAFAPFRLAHALLAALAPARTDRGGDSGGGDRGGGGGRVALTAPGA
ADAPGAGATAGIHWYSQLLYQIGTWLLDSEALHPLGMAVKSS
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgctgctgctggcgagatgtctgctgctagtcctcgtctcctcgctgctggtatgctcg
ggactggcgtgcggaccgggcagggggttcgggaagaggaggcaccccaaaaagctgacc
cctttagcctacaagcagtttatccccaatgtggccgagaagaccctaggcgccagcgga
aggtatgaagggaagatctccagaaactccgagcgatttaaggaactcacccccaattac
aaccccgacatcatatttaaggatgaagaaaacaccggagcggacaggctgatgactcag
aggtgtaaggacaagttgaacgctttggccatctcggtgatgaaccagtggccaggagtg
aaactgcgggtgaccgagggctgggacgaagatggccaccactcagaggagtctctgcac
tacgagggccgcgcagtggacatcaccacgtctgaccgcgaccgcagcaagtacggcatg
ctggcccgcctggcggtggaggccggcttcgactgggtgtactacgagtccaaggcacat
atccactgctcggtgaaagcagagaactcggtggcggccaaatcgggaggctgcttcccg
ggctcggccacggtgcacctggagcagggcggcaccaagctggtgaaggacctgagcccc
ggggaccgcgtgctggcggcggacgaccagggccggctgctctacagcgacttcctcact
ttcctggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacgcgggagccg
cgcgagcgcctgctgctcaccgccgcgcacctgctctttgtggcgccgcacaacgactcg
gccaccggggagcccgaggcgtcctcgggctcggggccgccttccgggggcgcactgggg
cctcgggcgctgttcgccagccgcgtgcgcccgggccagcgcgtgtacgtggtggccgag
cgtgacggggaccgccggctcctgcccgccgctgtgcacagcgtgaccctaagcgaggag
gccgcgggcgcctacgcgccgctcacggcccagggcaccattctcatcaaccgggtgctg
gcctcgtgctacgcggtcatcgaggagcacagctgggcgcaccgggccttcgcgcccttc
cgcctggcgcacgcgctcctggctgcactggcgcccgcgcgcacggaccgcggcggggac
agcggcggcggggaccgcgggggcggcggcggcagagtagccctaaccgctccaggtgct
gccgacgctccgggtgcgggggccaccgcgggcatccactggtactcgcagctgctctac
caaataggcacctggctcctggacagcgaggccctgcacccgctgggcatggcggtcaag
tccagctga

DBGET integrated database retrieval system