KEGG   Homo sapiens (human): 355Help
Entry
355               CDS       T01001                                 

Gene name
FAS, ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6
Definition
(RefSeq) Fas cell surface death receptor
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa04668  TNF signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04940  Type I diabetes mellitus
hsa05010  Alzheimer disease
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
Network
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00448  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
Disease
H00005  Chronic lymphocytic leukemia (CLL)
H00007  Hodgkin lymphoma
H00009  Adult T-cell leukemia
H00017  Esophageal cancer
H01463  Mycosis fungoides
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    355 (FAS)
   04668 TNF signaling pathway
    355 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    355 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    355 (FAS)
   04217 Necroptosis
    355 (FAS)
   04115 p53 signaling pathway
    355 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    355 (FAS)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    355 (FAS)
   05205 Proteoglycans in cancer
    355 (FAS)
  09163 Immune diseases
   05320 Autoimmune thyroid disease
    355 (FAS)
   05330 Allograft rejection
    355 (FAS)
   05332 Graft-versus-host disease
    355 (FAS)
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    355 (FAS)
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    355 (FAS)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    355 (FAS)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    355 (FAS)
   05162 Measles
    355 (FAS)
   05164 Influenza A
    355 (FAS)
   05161 Hepatitis B
    355 (FAS)
   05168 Herpes simplex infection
    355 (FAS)
   05163 Human cytomegalovirus infection
    355 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    355 (FAS)
   05169 Epstein-Barr virus infection
    355 (FAS)
   05165 Human papillomavirus infection
    355 (FAS)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    355 (FAS)
   05143 African trypanosomiasis
    355 (FAS)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    355 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    355 (FAS)
   04090 CD molecules [BR:hsa04090]
    355 (FAS)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   355 (FAS)
CD molecules [BR:hsa04090]
 Proteins
  355 (FAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death Peptidase_C8
Motif
Other DBs
NCBI-GeneID: 355
NCBI-ProteinID: NP_000034
OMIM: 134637
HGNC: 11920
Ensembl: ENSG00000026103
Vega: OTTHUMG00000018701
Pharos: P25445(Tbio)
UniProt: P25445
Structure
PDB: 

Position
10q23.31
AA seq 335 aa AA seqDB search
MLGIWTLLPLVLTSVARLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCH
KPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCT
RTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLL
LLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVM
TLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKK
ANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcatctggaccctcctacctctggttcttacgtctgttgctagattatcgtcc
aaaagtgttaatgcccaagtgactgacatcaactccaagggattggaattgaggaagact
gttactacagttgagactcagaacttggaaggcctgcatcatgatggccaattctgccat
aagccctgtcctccaggtgaaaggaaagctagggactgcacagtcaatggggatgaacca
gactgcgtgccctgccaagaagggaaggagtacacagacaaagcccatttttcttccaaa
tgcagaagatgtagattgtgtgatgaaggacatggcttagaagtggaaataaactgcacc
cggacccagaataccaagtgcagatgtaaaccaaactttttttgtaactctactgtatgt
gaacactgtgacccttgcaccaaatgtgaacatggaatcatcaaggaatgcacactcacc
agcaacaccaagtgcaaagaggaaggatccagatctaacttggggtggctttgtcttctt
cttttgccaattccactaattgtttgggtgaagagaaaggaagtacagaaaacatgcaga
aagcacagaaaggaaaaccaaggttctcatgaatctccaactttaaatcctgaaacagtg
gcaataaatttatctgatgttgacttgagtaaatatatcaccactattgctggagtcatg
acactaagtcaagttaaaggctttgttcgaaagaatggtgtcaatgaagccaaaatagat
gagatcaagaatgacaatgtccaagacacagcagaacagaaagttcaactgcttcgtaat
tggcatcaacttcatggaaagaaagaagcgtatgacacattgattaaagatctcaaaaaa
gccaatctttgtactcttgcagagaaaattcagactatcatcctcaaggacattactagt
gactcagaaaattcaaacttcagaaatgaaatccaaagcttggtctag

DBGET integrated database retrieval system