Entry |
|
Symbol |
IL1B, IL-1, IL1-BETA, IL1F2, IL1beta
|
Name |
(RefSeq) interleukin 1 beta
|
KO |
|
Organism |
|
Pathway |
hsa04060 | Cytokine-cytokine receptor interaction |
hsa04620 | Toll-like receptor signaling pathway |
hsa04621 | NOD-like receptor signaling pathway |
hsa04625 | C-type lectin receptor signaling pathway |
hsa04750 | Inflammatory mediator regulation of TRP channels |
hsa04932 | Non-alcoholic fatty liver disease |
hsa04933 | AGE-RAGE signaling pathway in diabetic complications |
hsa05022 | Pathways of neurodegeneration - multiple diseases |
hsa05130 | Pathogenic Escherichia coli infection |
hsa05163 | Human cytomegalovirus infection |
hsa05168 | Herpes simplex virus 1 infection |
hsa05418 | Fluid shear stress and atherosclerosis |
|
Network |
nt06110 MAPK signaling (viruses and bacteria) nt06164 Kaposi sarcoma-associated herpesvirus (KSHV) nt06170 Influenza A virus (IAV) nt06171 Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) nt06211 Other MAPK signaling nt06521 NLR signaling |
Element |
N00186 | IL1-IL1R-p38 signaling pathway |
N00188 | IL1-IL1R-JNK signaling pathway |
N00742 | NLRP3 inflammasome signaling pathway |
N00867 | NLRC4 inflammasome signaling pathway |
N00868 | Pyrin inflammasome signaling pathway |
N00934 | Non-canonical inflammasome signaling pathway |
N00948 | Shigella IpaH7.8 to NLRP3 Inflammasome signaling pathway |
N00949 | Shigella IpaB to NLRC4 Inflammasome signaling pathway |
N01126 | Salmonella SipB to Inflammasome signaling pathway |
N01127 | Salmonella SopE to Inflammasome signaling pathway |
N01307 | SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway |
N01567 | NLRP1 inflammasome signaling pathway |
N01569 | NALP12 inflammasome signaling pathway |
|
Disease |
|
Drug target |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
3553 (IL1B)
04064 NF-kappa B signaling pathway
3553 (IL1B)
04668 TNF signaling pathway
3553 (IL1B)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
3553 (IL1B)
09140 Cellular Processes
09143 Cell growth and death
04217 Necroptosis
3553 (IL1B)
09150 Organismal Systems
09151 Immune system
04640 Hematopoietic cell lineage
3553 (IL1B)
04620 Toll-like receptor signaling pathway
3553 (IL1B)
04621 NOD-like receptor signaling pathway
3553 (IL1B)
04623 Cytosolic DNA-sensing pathway
3553 (IL1B)
04625 C-type lectin receptor signaling pathway
3553 (IL1B)
04659 Th17 cell differentiation
3553 (IL1B)
04657 IL-17 signaling pathway
3553 (IL1B)
09157 Sensory system
04750 Inflammatory mediator regulation of TRP channels
3553 (IL1B)
09158 Development and regeneration
04380 Osteoclast differentiation
3553 (IL1B)
09160 Human Diseases
09172 Infectious disease: viral
05171 Coronavirus disease - COVID-19
3553 (IL1B)
05164 Influenza A
3553 (IL1B)
05162 Measles
3553 (IL1B)
05168 Herpes simplex virus 1 infection
3553 (IL1B)
05163 Human cytomegalovirus infection
3553 (IL1B)
09171 Infectious disease: bacterial
05130 Pathogenic Escherichia coli infection
3553 (IL1B)
05132 Salmonella infection
3553 (IL1B)
05131 Shigellosis
3553 (IL1B)
05135 Yersinia infection
3553 (IL1B)
05133 Pertussis
3553 (IL1B)
05134 Legionellosis
3553 (IL1B)
05152 Tuberculosis
3553 (IL1B)
09174 Infectious disease: parasitic
05146 Amoebiasis
3553 (IL1B)
05144 Malaria
3553 (IL1B)
05140 Leishmaniasis
3553 (IL1B)
05142 Chagas disease
3553 (IL1B)
05143 African trypanosomiasis
3553 (IL1B)
09163 Immune disease
05323 Rheumatoid arthritis
3553 (IL1B)
05321 Inflammatory bowel disease
3553 (IL1B)
05332 Graft-versus-host disease
3553 (IL1B)
09164 Neurodegenerative disease
05010 Alzheimer disease
3553 (IL1B)
05020 Prion disease
3553 (IL1B)
05022 Pathways of neurodegeneration - multiple diseases
3553 (IL1B)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
3553 (IL1B)
05418 Fluid shear stress and atherosclerosis
3553 (IL1B)
09167 Endocrine and metabolic disease
04940 Type I diabetes mellitus
3553 (IL1B)
04936 Alcoholic liver disease
3553 (IL1B)
04932 Non-alcoholic fatty liver disease
3553 (IL1B)
04933 AGE-RAGE signaling pathway in diabetic complications
3553 (IL1B)
09176 Drug resistance: antineoplastic
01523 Antifolate resistance
3553 (IL1B)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and growth factors [BR:hsa04052]
3553 (IL1B)
00536 Glycosaminoglycan binding proteins [BR:hsa00536]
3553 (IL1B)
Cytokines and growth factors [BR:hsa04052]
Cytokines
Interleukins
3553 (IL1B)
Glycosaminoglycan binding proteins [BR:hsa00536]
Heparan sulfate / Heparin
Cytokines
3553 (IL1B)
|
SSDB |
|
Motif |
|
Other DBs |
|
Structure |
|
Position |
2:complement(112829751..112836779)
|
AA seq |
269 aa
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS |
NT seq |
810 nt +upstreamnt +downstreamnt
atggcagaagtacctgagctcgccagtgaaatgatggcttattacagtggcaatgaggat
gacttgttctttgaagctgatggccctaaacagatgaagtgctccttccaggacctggac
ctctgccctctggatggcggcatccagctacgaatctccgaccaccactacagcaagggc
ttcaggcaggccgcgtcagttgttgtggccatggacaagctgaggaagatgctggttccc
tgcccacagaccttccaggagaatgacctgagcaccttctttcccttcatctttgaagaa
gaacctatcttcttcgacacatgggataacgaggcttatgtgcacgatgcacctgtacga
tcactgaactgcacgctccgggactcacagcaaaaaagcttggtgatgtctggtccatat
gaactgaaagctctccacctccagggacaggatatggagcaacaagtggtgttctccatg
tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggaa
aagaatctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagt
gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata
gaaatcaataacaagctggaatttgagtctgcccagttccccaactggtacatcagcacc
tctcaagcagaaaacatgcccgtcttcctgggagggaccaaaggcggccaggatataact
gacttcaccatgcaatttgtgtcttcctaa |