KEGG   Homo sapiens (human): 3553Help
Entry
3553              CDS       T01001                                 

Gene name
IL1B, IL-1, IL1-BETA, IL1F2
Definition
(RefSeq) interleukin 1 beta
  KO
K04519  interleukin 1 beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04940  Type I diabetes mellitus
hsa05010  Alzheimer disease
hsa05020  Prion diseases
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex infection
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05332  Graft-versus-host disease
hsa05418  Fluid shear stress and atherosclerosis
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
Disease
H01492  Systemic sclerosis
Drug target
Canakinumab: D09315
Gevokizumab: D09911
Pirfenidone: D01583
Rilonacept: D06635
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3553 (IL1B)
   04064 NF-kappa B signaling pathway
    3553 (IL1B)
   04668 TNF signaling pathway
    3553 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3553 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3553 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3553 (IL1B)
   04620 Toll-like receptor signaling pathway
    3553 (IL1B)
   04621 NOD-like receptor signaling pathway
    3553 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    3553 (IL1B)
   04625 C-type lectin receptor signaling pathway
    3553 (IL1B)
   04659 Th17 cell differentiation
    3553 (IL1B)
   04657 IL-17 signaling pathway
    3553 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3553 (IL1B)
  09158 Development
   04380 Osteoclast differentiation
    3553 (IL1B)
 09160 Human Diseases
  09162 Immune diseases
   05323 Rheumatoid arthritis
    3553 (IL1B)
   05321 Inflammatiory bowel disease (IBD)
    3553 (IL1B)
   05332 Graft-versus-host disease
    3553 (IL1B)
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    3553 (IL1B)
   05020 Prion diseases
    3553 (IL1B)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3553 (IL1B)
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3553 (IL1B)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3553 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3553 (IL1B)
  09167 Infectious diseases
   05132 Salmonella infection
    3553 (IL1B)
   05133 Pertussis
    3553 (IL1B)
   05134 Legionellosis
    3553 (IL1B)
   05152 Tuberculosis
    3553 (IL1B)
   05162 Measles
    3553 (IL1B)
   05164 Influenza A
    3553 (IL1B)
   05168 Herpes simplex infection
    3553 (IL1B)
   05163 Human cytomegalovirus infection
    3553 (IL1B)
   05146 Amoebiasis
    3553 (IL1B)
   05144 Malaria
    3553 (IL1B)
   05140 Leishmaniasis
    3553 (IL1B)
   05142 Chagas disease (American trypanosomiasis)
    3553 (IL1B)
   05143 African trypanosomiasis
    3553 (IL1B)
  09168 Drug resistance
   01523 Antifolate resistance
    3553 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3553 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3553 (IL1B)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3553 (IL1B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   3553 (IL1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1 IL1_propep Inhibitor_I71
Motif
Other DBs
NCBI-GeneID: 3553
NCBI-ProteinID: NP_000567
OMIM: 147720
HGNC: 5992
Ensembl: ENSG00000125538
Vega: OTTHUMG00000131344
Pharos: P01584(Tclin)
UniProt: P01584
Structure
PDB: 

Position
2q14.1
AA seq 269 aa AA seqDB search
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtacctgagctcgccagtgaaatgatggcttattacagtggcaatgaggat
gacttgttctttgaagctgatggccctaaacagatgaagtgctccttccaggacctggac
ctctgccctctggatggcggcatccagctacgaatctccgaccaccactacagcaagggc
ttcaggcaggccgcgtcagttgttgtggccatggacaagctgaggaagatgctggttccc
tgcccacagaccttccaggagaatgacctgagcaccttctttcccttcatctttgaagaa
gaacctatcttcttcgacacatgggataacgaggcttatgtgcacgatgcacctgtacga
tcactgaactgcacgctccgggactcacagcaaaaaagcttggtgatgtctggtccatat
gaactgaaagctctccacctccagggacaggatatggagcaacaagtggtgttctccatg
tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggaa
aagaatctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagt
gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata
gaaatcaataacaagctggaatttgagtctgcccagttccccaactggtacatcagcacc
tctcaagcagaaaacatgcccgtcttcctgggagggaccaaaggcggccaggatataact
gacttcaccatgcaatttgtgtcttcctaa

DBGET integrated database retrieval system