KEGG   Homo sapiens (human): 3554Help
Entry
3554              CDS       T01001                                 

Gene name
IL1R1, CD121A, D2S1473, IL-1R-alpha, IL1R, IL1RA, P80
Definition
(RefSeq) interleukin 1 receptor type 1
  KO
K04386  interleukin 1 receptor type I
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04640  Hematopoietic cell lineage
hsa04659  Th17 cell differentiation
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05418  Fluid shear stress and atherosclerosis
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
Disease
H01492  Systemic sclerosis
Drug target
Anakinra: D02934
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3554 (IL1R1)
   04064 NF-kappa B signaling pathway
    3554 (IL1R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3554 (IL1R1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3554 (IL1R1)
   04659 Th17 cell differentiation
    3554 (IL1R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3554 (IL1R1)
  09158 Development
   04380 Osteoclast differentiation
    3554 (IL1R1)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3554 (IL1R1)
  09167 Infectious diseases
   05166 HTLV-I infection
    3554 (IL1R1)
   05163 Human cytomegalovirus infection
    3554 (IL1R1)
   05146 Amoebiasis
    3554 (IL1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3554 (IL1R1)
   04090 CD Molecules [BR:hsa04090]
    3554 (IL1R1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   3554 (IL1R1)
CD molecules [BR:hsa04090]
 Proteins
  3554 (IL1R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_3 I-set Ig_2 ig Ig_5
Motif
Other DBs
NCBI-GeneID: 3554
NCBI-ProteinID: NP_000868
OMIM: 147810
HGNC: 5993
Ensembl: ENSG00000115594
Vega: OTTHUMG00000130783
Pharos: P14778(Tclin)
UniProt: P14778
Structure
PDB: 

Position
2q11.2-q12.1
AA seq 569 aa AA seqDB search
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLLSPATKEKLQREAHVPLG
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgttactcagacttatttgtttcatagctctactgatttcttctctggaggct
gataaatgcaaggaacgtgaagaaaaaataattttagtgtcatctgcaaatgaaattgat
gttcgtccctgtcctcttaacccaaatgaacacaaaggcactataacttggtataaagat
gacagcaagacacctgtatctacagaacaagcctccaggattcatcaacacaaagagaaa
ctttggtttgttcctgctaaggtggaggattcaggacattactattgcgtggtaagaaat
tcatcttactgcctcagaattaaaataagtgcaaaatttgtggagaatgagcctaactta
tgttataatgcacaagccatatttaagcagaaactacccgttgcaggagacggaggactt
gtgtgcccttatatggagttttttaaaaatgaaaataatgagttacctaaattacagtgg
tataaggattgcaaacctctacttcttgacaatatacactttagtggagtcaaagatagg
ctcatcgtgatgaatgtggctgaaaagcatagagggaactatacttgtcatgcatcctac
acatacttgggcaagcaatatcctattacccgggtaatagaatttattactctagaggaa
aacaaacccacaaggcctgtgattgtgagcccagctaatgagacaatggaagtagacttg
ggatcccagatacaattgatctgtaatgtcaccggccagttgagtgacattgcttactgg
aagtggaatgggtcagtaattgatgaagatgacccagtgctaggggaagactattacagt
gtggaaaatcctgcaaacaaaagaaggagtaccctcatcacagtgcttaatatatcggaa
attgaaagtagattttataaacatccatttacctgttttgccaagaatacacatggtata
gatgcagcatatatccagttaatatatccagtcactaatttccagaagcacatgattggt
atatgtgtcacgttgacagtcataattgtgtgttctgttttcatctataaaatcttcaag
attgacattgtgctttggtacagggattcctgctatgattttctcccaataaaagcttca
gatggaaagacctatgacgcatatatactgtatccaaagactgttggggaagggtctacc
tctgactgtgatatttttgtgtttaaagtcttgcctgaggtcttggaaaaacagtgtgga
tataagctgttcatttatggaagggatgactacgttggggaagacattgttgaggtcatt
aatgaaaacgtaaagaaaagcagaagactgattatcattttagtcagagaaacatcaggc
ttcagctggctgggtggttcatctgaagagcaaatagccatgtataatgctcttgttcag
gatggaattaaagttgtcctgcttgagctggagaaaatccaagactatgagaaaatgcca
gaatcgattaaattcattaagcagaaacatggggctatccgctggtcaggggactttaca
cagggaccacagtctgcaaagacaaggttctggaagaatgtcaggtaccacatgccagtc
cagcgacggtcaccttcatctaaacaccagttactgtcaccagccactaaggagaaactg
caaagagaggctcacgtgcctctcgggtag

KEGG   Homo sapiens (human): 3556Help
Entry
3556              CDS       T01001                                 

Gene name
IL1RAP, C3orf13, IL-1RAcP, IL1R3
Definition
(RefSeq) interleukin 1 receptor accessory protein
  KO
K04723  interleukin 1 receptor accessory protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04659  Th17 cell differentiation
hsa04750  Inflammatory mediator regulation of TRP channels
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3556 (IL1RAP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3556 (IL1RAP)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    3556 (IL1RAP)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3556 (IL1RAP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3556 (IL1RAP)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   3556 (IL1RAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_3 Ig_2 ig I-set TIR_2
Motif
Other DBs
NCBI-GeneID: 3556
NCBI-ProteinID: NP_001161400
OMIM: 602626
HGNC: 5995
Ensembl: ENSG00000196083
Vega: OTTHUMG00000156211
Pharos: Q9NPH3(Tclin)
UniProt: Q9NPH3 A8K6K4
Structure
PDB: 

Position
3q28
AA seq 570 aa AA seqDB search
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL
LELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK
QLQVAMPVKKSPRRSSSDEQGLSYSSLKNV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgacacttctgtggtgtgtagtgagtctctacttttatggaatcctgcaaagtgatgcc
tcagaacgctgcgatgactggggactagacaccatgaggcaaatccaagtgtttgaagat
gagccagctcgcatcaagtgcccactctttgaacacttcttgaaattcaactacagcaca
gcccattcagctggccttactctgatctggtattggactaggcaggaccgggaccttgag
gagccaattaacttccgcctccccgagaaccgcattagtaaggagaaagatgtgctgtgg
ttccggcccactctcctcaatgacactggcaactatacctgcatgttaaggaacactaca
tattgcagcaaagttgcatttcccttggaagttgttcaaaaagacagctgtttcaattcc
cccatgaaactcccagtgcataaactgtatatagaatatggcattcagaggatcacttgt
ccaaatgtagatggatattttccttccagtgtcaaaccgactatcacttggtatatgggc
tgttataaaatacagaattttaataatgtaatacccgaaggtatgaacttgagtttcctc
attgccttaatttcaaataatggaaattacacatgtgttgttacatatccagaaaatgga
cgtacgtttcatctcaccaggactctgactgtaaaggtagtaggctctccaaaaaatgca
gtgccccctgtgatccattcacctaatgatcatgtggtctatgagaaagaaccaggagag
gagctactcattccctgtacggtctattttagttttctgatggattctcgcaatgaggtt
tggtggaccattgatggaaaaaaacctgatgacatcactattgatgtcaccattaacgaa
agtataagtcatagtagaacagaagatgaaacaagaactcagattttgagcatcaagaaa
gttacctctgaggatctcaagcgcagctatgtctgtcatgctagaagtgccaaaggcgaa
gttgccaaagcagccaaggtgaagcagaaagtgccagctccaagatacacagtggaactg
gcttgtggttttggagccacagtcctgctagtggtgattctcattgttgtttaccatgtt
tactggctagagatggtcctattttaccgggctcattttggaacagatgaaaccatttta
gatggaaaagagtatgatatttatgtatcctatgcaaggaatgcggaagaagaagaattt
gtattactgaccctccgtggagttttggagaatgaatttggatacaagctgtgcatcttt
gaccgagacagtctgcctgggggaattgtcacagatgagactttgagcttcattcagaaa
agcagacgcctcctggttgttctaagccccaactacgtgctccagggaacccaagccctc
ctggagctcaaggctggcctagaaaatatggcctctcggggcaacatcaacgtcatttta
gtacagtacaaagctgtgaaggaaacgaaggtgaaagagctgaagagggctaagacggtg
ctcacggtcattaaatggaaaggggaaaaatccaagtatccacagggcaggttctggaag
cagctgcaggtggccatgccagtgaagaaaagtcccaggcggtctagcagtgatgagcag
ggcctctcgtattcatctttgaaaaatgtatga

DBGET integrated database retrieval system