KEGG   Homo sapiens (human): 3554Help
Entry
3554              CDS       T01001                                 

Gene name
IL1R1, CD121A, D2S1473, IL-1R-alpha, IL1R, IL1RA, P80
Definition
(RefSeq) interleukin 1 receptor type 1
  KO
K04386  interleukin 1 receptor type I
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04640  Hematopoietic cell lineage
hsa04659  Th17 cell differentiation
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05166  HTLV-I infection
hsa05418  Fluid shear stress and atherosclerosis
Network
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
Disease
H01492  Systemic sclerosis
Drug target
Anakinra: D02934
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3554 (IL1R1)
   04064 NF-kappa B signaling pathway
    3554 (IL1R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3554 (IL1R1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3554 (IL1R1)
   04659 Th17 cell differentiation
    3554 (IL1R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3554 (IL1R1)
  09158 Development
   04380 Osteoclast differentiation
    3554 (IL1R1)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    3554 (IL1R1)
  09167 Infectious diseases
   05166 HTLV-I infection
    3554 (IL1R1)
   05163 Human cytomegalovirus infection
    3554 (IL1R1)
   05146 Amoebiasis
    3554 (IL1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3554 (IL1R1)
   04090 CD Molecules [BR:hsa04090]
    3554 (IL1R1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   3554 (IL1R1)
CD molecules [BR:hsa04090]
 Proteins
  3554 (IL1R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_3 I-set Ig_2 ig Ig_5
Motif
Other DBs
NCBI-GeneID: 3554
NCBI-ProteinID: NP_000868
OMIM: 147810
HGNC: 5993
Ensembl: ENSG00000115594
Vega: OTTHUMG00000130783
Pharos: P14778(Tclin)
UniProt: P14778
Structure
PDB: 

Position
2q11.2-q12.1
AA seq 569 aa AA seqDB search
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGTITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKISAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLLSPATKEKLQREAHVPLG
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgttactcagacttatttgtttcatagctctactgatttcttctctggaggct
gataaatgcaaggaacgtgaagaaaaaataattttagtgtcatctgcaaatgaaattgat
gttcgtccctgtcctcttaacccaaatgaacacaaaggcactataacttggtataaagat
gacagcaagacacctgtatctacagaacaagcctccaggattcatcaacacaaagagaaa
ctttggtttgttcctgctaaggtggaggattcaggacattactattgcgtggtaagaaat
tcatcttactgcctcagaattaaaataagtgcaaaatttgtggagaatgagcctaactta
tgttataatgcacaagccatatttaagcagaaactacccgttgcaggagacggaggactt
gtgtgcccttatatggagttttttaaaaatgaaaataatgagttacctaaattacagtgg
tataaggattgcaaacctctacttcttgacaatatacactttagtggagtcaaagatagg
ctcatcgtgatgaatgtggctgaaaagcatagagggaactatacttgtcatgcatcctac
acatacttgggcaagcaatatcctattacccgggtaatagaatttattactctagaggaa
aacaaacccacaaggcctgtgattgtgagcccagctaatgagacaatggaagtagacttg
ggatcccagatacaattgatctgtaatgtcaccggccagttgagtgacattgcttactgg
aagtggaatgggtcagtaattgatgaagatgacccagtgctaggggaagactattacagt
gtggaaaatcctgcaaacaaaagaaggagtaccctcatcacagtgcttaatatatcggaa
attgaaagtagattttataaacatccatttacctgttttgccaagaatacacatggtata
gatgcagcatatatccagttaatatatccagtcactaatttccagaagcacatgattggt
atatgtgtcacgttgacagtcataattgtgtgttctgttttcatctataaaatcttcaag
attgacattgtgctttggtacagggattcctgctatgattttctcccaataaaagcttca
gatggaaagacctatgacgcatatatactgtatccaaagactgttggggaagggtctacc
tctgactgtgatatttttgtgtttaaagtcttgcctgaggtcttggaaaaacagtgtgga
tataagctgttcatttatggaagggatgactacgttggggaagacattgttgaggtcatt
aatgaaaacgtaaagaaaagcagaagactgattatcattttagtcagagaaacatcaggc
ttcagctggctgggtggttcatctgaagagcaaatagccatgtataatgctcttgttcag
gatggaattaaagttgtcctgcttgagctggagaaaatccaagactatgagaaaatgcca
gaatcgattaaattcattaagcagaaacatggggctatccgctggtcaggggactttaca
cagggaccacagtctgcaaagacaaggttctggaagaatgtcaggtaccacatgccagtc
cagcgacggtcaccttcatctaaacaccagttactgtcaccagccactaaggagaaactg
caaagagaggctcacgtgcctctcgggtag

KEGG   Homo sapiens (human): 7850Help
Entry
7850              CDS       T01001                                 

Gene name
IL1R2, CD121b, CDw121b, IL-1R-2, IL-1RT-2, IL-1RT2, IL1R2c, IL1RB
Definition
(RefSeq) interleukin 1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04640  Hematopoietic cell lineage
hsa05146  Amoebiasis
hsa05166  HTLV-I infection
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
N00128  TMPRSS2-ERG fusion to transcriptional activation
Drug target
Anakinra: D02934
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    7850 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    7850 (IL1R2)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    7850 (IL1R2)
   05215 Prostate cancer
    7850 (IL1R2)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    7850 (IL1R2)
  09167 Infectious diseases
   05166 HTLV-I infection
    7850 (IL1R2)
   05146 Amoebiasis
    7850 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    7850 (IL1R2)
   04090 CD Molecules [BR:hsa04090]
    7850 (IL1R2)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   7850 (IL1R2)
CD molecules [BR:hsa04090]
 Proteins
  7850 (IL1R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ig Ig_3 I-set Ig_2 V-set Ig_5 Izumo-Ig stn_TNFRSF12A
Motif
Other DBs
NCBI-GeneID: 7850
NCBI-ProteinID: NP_004624
OMIM: 147811
HGNC: 5994
Ensembl: ENSG00000115590
Vega: OTTHUMG00000130695
Pharos: P27930(Tbio)
UniProt: P27930
Structure
PDB: 

Position
2q11.2
AA seq 398 aa AA seqDB search
MLRLYVLVMGVSAFTLQPAAHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
IELRVFENTDAFLPFISYPQILTLSTSGVLVCPDLSEFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHDVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVHNTLSFQTLRTTVKEASSTFSWGIVLAPLSLA
FLVLGGIWMHRRCKHRTGKADGLTVLWPHHQDFQSYPK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcttgtacgtgttggtaatgggagtttctgccttcacccttcagcctgcggca
cacacaggggctgccagaagctgccggtttcgtgggaggcattacaagcgggagttcagg
ctggaaggggagcctgtagccctgaggtgcccccaggtgccctactggttgtgggcctct
gtcagcccccgcatcaacctgacatggcataaaaatgactctgctaggacggtcccagga
gaagaagagacacggatgtgggcccaggacggtgctctgtggcttctgccagccttgcag
gaggactctggcacctacgtctgcactactagaaatgcttcttactgtgacaaaatgtcc
attgagctcagagtttttgagaatacagatgctttcctgccgttcatctcatacccgcaa
attttaaccttgtcaacctctggggtattagtatgccctgacctgagtgaattcacccgt
gacaaaactgacgtgaagattcaatggtacaaggattctcttcttttggataaagacaat
gagaaatttctaagtgtgagggggaccactcacttactcgtacacgatgtggccctggaa
gatgctggctattaccgctgtgtcctgacatttgcccatgaaggccagcaatacaacatc
actaggagtattgagctacgcatcaagaaaaaaaaagaagagaccattcctgtgatcatt
tcccccctcaagaccatatcagcttctctggggtcaagactgacaatcccgtgtaaggtg
tttctgggaaccggcacacccttaaccaccatgctgtggtggacggccaatgacacccac
atagagagcgcctacccgggaggccgcgtgaccgaggggccacgccaggaatattcagaa
aataatgagaactacattgaagtgccattgatttttgatcctgtcacaagagaggatttg
cacatggattttaaatgtgttgtccataataccctgagttttcagacactacgcaccaca
gtcaaggaagcctcctccacgttctcctggggcattgtgctggccccactttcactggcc
ttcttggttttggggggaatatggatgcacagacggtgcaaacacagaactggaaaagca
gatggtctgactgtgctatggcctcatcatcaagactttcaatcctatcccaagtga

DBGET integrated database retrieval system