KEGG   Homo sapiens (human): 3556Help
Entry
3556              CDS       T01001                                 

Gene name
IL1RAP, C3orf13, IL-1RAcP, IL1R3
Definition
(RefSeq) interleukin 1 receptor accessory protein
  KO
K04723  interleukin 1 receptor accessory protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04659  Th17 cell differentiation
hsa04750  Inflammatory mediator regulation of TRP channels
Network
nt06110  MAPK signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
  Element
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3556 (IL1RAP)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3556 (IL1RAP)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    3556 (IL1RAP)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3556 (IL1RAP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3556 (IL1RAP)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   3556 (IL1RAP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR Ig_6 Ig_3 Ig_2 TIR_2 ig I-set
Motif
Other DBs
NCBI-GeneID: 3556
NCBI-ProteinID: NP_001161400
OMIM: 602626
HGNC: 5995
Ensembl: ENSG00000196083
Vega: OTTHUMG00000156211
Pharos: Q9NPH3(Tclin)
UniProt: Q9NPH3 A8K6K4
Structure
PDB: 

Position
3q28
AA seq 570 aa AA seqDB search
MTLLWCVVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYST
AHSAGLTLIWYWTRQDRDLEEPINFRLPENRISKEKDVLWFRPTLLNDTGNYTCMLRNTT
YCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMG
CYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNA
VPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINE
SISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVEL
ACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILDGKEYDIYVSYARNAEEEEF
VLLTLRGVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQGTQAL
LELKAGLENMASRGNINVILVQYKAVKETKVKELKRAKTVLTVIKWKGEKSKYPQGRFWK
QLQVAMPVKKSPRRSSSDEQGLSYSSLKNV
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgacacttctgtggtgtgtagtgagtctctacttttatggaatcctgcaaagtgatgcc
tcagaacgctgcgatgactggggactagacaccatgaggcaaatccaagtgtttgaagat
gagccagctcgcatcaagtgcccactctttgaacacttcttgaaattcaactacagcaca
gcccattcagctggccttactctgatctggtattggactaggcaggaccgggaccttgag
gagccaattaacttccgcctccccgagaaccgcattagtaaggagaaagatgtgctgtgg
ttccggcccactctcctcaatgacactggcaactatacctgcatgttaaggaacactaca
tattgcagcaaagttgcatttcccttggaagttgttcaaaaagacagctgtttcaattcc
cccatgaaactcccagtgcataaactgtatatagaatatggcattcagaggatcacttgt
ccaaatgtagatggatattttccttccagtgtcaaaccgactatcacttggtatatgggc
tgttataaaatacagaattttaataatgtaatacccgaaggtatgaacttgagtttcctc
attgccttaatttcaaataatggaaattacacatgtgttgttacatatccagaaaatgga
cgtacgtttcatctcaccaggactctgactgtaaaggtagtaggctctccaaaaaatgca
gtgccccctgtgatccattcacctaatgatcatgtggtctatgagaaagaaccaggagag
gagctactcattccctgtacggtctattttagttttctgatggattctcgcaatgaggtt
tggtggaccattgatggaaaaaaacctgatgacatcactattgatgtcaccattaacgaa
agtataagtcatagtagaacagaagatgaaacaagaactcagattttgagcatcaagaaa
gttacctctgaggatctcaagcgcagctatgtctgtcatgctagaagtgccaaaggcgaa
gttgccaaagcagccaaggtgaagcagaaagtgccagctccaagatacacagtggaactg
gcttgtggttttggagccacagtcctgctagtggtgattctcattgttgtttaccatgtt
tactggctagagatggtcctattttaccgggctcattttggaacagatgaaaccatttta
gatggaaaagagtatgatatttatgtatcctatgcaaggaatgcggaagaagaagaattt
gtattactgaccctccgtggagttttggagaatgaatttggatacaagctgtgcatcttt
gaccgagacagtctgcctgggggaattgtcacagatgagactttgagcttcattcagaaa
agcagacgcctcctggttgttctaagccccaactacgtgctccagggaacccaagccctc
ctggagctcaaggctggcctagaaaatatggcctctcggggcaacatcaacgtcatttta
gtacagtacaaagctgtgaaggaaacgaaggtgaaagagctgaagagggctaagacggtg
ctcacggtcattaaatggaaaggggaaaaatccaagtatccacagggcaggttctggaag
cagctgcaggtggccatgccagtgaagaaaagtcccaggcggtctagcagtgatgagcag
ggcctctcgtattcatctttgaaaaatgtatga

DBGET integrated database retrieval system