KEGG   Homo sapiens (human): 3559Help
Entry
3559              CDS       T01001                                 

Gene name
IL2RA, CD25, IDDM10, IL2R, IMD41, TCGFR, p55
Definition
(RefSeq) interleukin 2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00091  T-B+Severe combined immunodeficiency
H00408  Type 1 diabetes mellitus
Drug target
Aldesleukin: D00748
Antithymocyte immunoglobulin (rabbit): D09190
Basiliximab: D03058
Celmoleukin: D02743
Daclizumab: D03639
Denileukin diftitox: D03682
Teceleukin: D02749
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3559 (IL2RA)
   04151 PI3K-Akt signaling pathway
    3559 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3559 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3559 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3559 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    3559 (IL2RA)
   04659 Th17 cell differentiation
    3559 (IL2RA)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3559 (IL2RA)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    3559 (IL2RA)
   05162 Measles
    3559 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3559 (IL2RA)
   04090 CD molecules [BR:hsa04090]
    3559 (IL2RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3559 (IL2RA)
CD molecules [BR:hsa04090]
 Proteins
  3559 (IL2RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi
Motif
Other DBs
NCBI-GeneID: 3559
NCBI-ProteinID: NP_000408
OMIM: 147730
HGNC: 6008
Ensembl: ENSG00000134460
Vega: OTTHUMG00000017616
Pharos: P01589(Tclin)
UniProt: P01589
Structure
PDB: 

Position
10p15.1
AA seq 272 aa AA seqDB search
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggattcatacctgctgatgtggggactgctcacgttcatcatggtgcctggctgccag
gcagagctctgtgacgatgacccgccagagatcccacacgccacattcaaagccatggcc
tacaaggaaggaaccatgttgaactgtgaatgcaagagaggtttccgcagaataaaaagc
gggtcactctatatgctctgtacaggaaactctagccactcgtcctgggacaaccaatgt
caatgcacaagctctgccactcggaacacaacgaaacaagtgacacctcaacctgaagaa
cagaaagaaaggaaaaccacagaaatgcaaagtccaatgcagccagtggaccaagcgagc
cttccaggtcactgcagggaacctccaccatgggaaaatgaagccacagagagaatttat
catttcgtggtggggcagatggtttattatcagtgcgtccagggatacagggctctacac
agaggtcctgctgagagcgtctgcaaaatgacccacgggaagacaaggtggacccagccc
cagctcatatgcacaggtgaaatggagaccagtcagtttccaggtgaagagaagcctcag
gcaagccccgaaggccgtcctgagagtgagacttcctgcctcgtcacaacaacagatttt
caaatacagacagaaatggctgcaaccatggagacgtccatatttacaacagagtaccag
gtagcagtggccggctgtgttttcctgctgatcagcgtcctcctcctgagtgggctcacc
tggcagcggagacagaggaagagtagaagaacaatctag

DBGET integrated database retrieval system