KEGG   Homo sapiens (human): 356Help
Entry
356               CDS       T01001                                 

Gene name
FASLG, ALPS1B, APT1LG1, APTL, CD178, CD95-L, CD95L, FASL, TNFSF6, TNLG1A
Definition
(RefSeq) Fas ligand
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa04722  Neurotrophin signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04940  Type I diabetes mellitus
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05168  Herpes simplex infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
Network
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00448  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
Disease
H00108  Autoimmune lymphoproliferative syndromes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    356 (FASLG)
   04010 MAPK signaling pathway
    356 (FASLG)
   04068 FoxO signaling pathway
    356 (FASLG)
   04151 PI3K-Akt signaling pathway
    356 (FASLG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    356 (FASLG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    356 (FASLG)
   04217 Necroptosis
    356 (FASLG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    356 (FASLG)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    356 (FASLG)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    356 (FASLG)
   05205 Proteoglycans in cancer
    356 (FASLG)
  09163 Immune diseases
   05320 Autoimmune thyroid disease
    356 (FASLG)
   05330 Allograft rejection
    356 (FASLG)
   05332 Graft-versus-host disease
    356 (FASLG)
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    356 (FASLG)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    356 (FASLG)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    356 (FASLG)
   05162 Measles
    356 (FASLG)
   05164 Influenza A
    356 (FASLG)
   05161 Hepatitis B
    356 (FASLG)
   05168 Herpes simplex infection
    356 (FASLG)
   05163 Human cytomegalovirus infection
    356 (FASLG)
   05165 Human papillomavirus infection
    356 (FASLG)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    356 (FASLG)
   05143 African trypanosomiasis
    356 (FASLG)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    356 (FASLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    356 (FASLG)
   04052 Cytokines and growth factors [BR:hsa04052]
    356 (FASLG)
   04090 CD molecules [BR:hsa04090]
    356 (FASLG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   356 (FASLG)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   356 (FASLG)
CD molecules [BR:hsa04090]
 Proteins
  356 (FASLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF PAP_PilO
Motif
Other DBs
NCBI-GeneID: 356
NCBI-ProteinID: NP_000630
OMIM: 134638
HGNC: 11936
Ensembl: ENSG00000117560
Vega: OTTHUMG00000034841
Pharos: P48023(Tbio)
UniProt: P48023 Q53ZZ1
Structure
PDB: 

Position
1q24.3
AA seq 281 aa AA seqDB search
MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPP
PPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQ
MHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGG
LVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWA
RSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccttcaattacccatatccccagatctactgggtggacagcagtgccagc
tctccctgggcccctccaggcacagttcttccctgtccaacctctgtgcccagaaggcct
ggtcaaaggaggccaccaccaccaccgccaccgccaccactaccacctccgccgccgccg
ccaccactgcctccactaccgctgccacccctgaagaagagagggaaccacagcacaggc
ctgtgtctccttgtgatgtttttcatggttctggttgccttggtaggattgggcctgggg
atgtttcagctcttccacctacagaaggagctggcagaactccgagagtctaccagccag
atgcacacagcatcatctttggagaagcaaataggccaccccagtccaccccctgaaaaa
aaggagctgaggaaagtggcccatttaacaggcaagtccaactcaaggtccatgcctctg
gaatgggaagacacctatggaattgtcctgctttctggagtgaagtataagaagggtggc
cttgtgatcaatgaaactgggctgtactttgtatattccaaagtatacttccggggtcaa
tcttgcaacaacctgcccctgagccacaaggtctacatgaggaactctaagtatccccag
gatctggtgatgatggaggggaagatgatgagctactgcactactgggcagatgtgggcc
cgcagcagctacctgggggcagtgttcaatcttaccagtgctgatcatttatatgtcaac
gtatctgagctctctctggtcaattttgaggaatctcagacgtttttcggcttatataag
ctctaa

DBGET integrated database retrieval system