KEGG   Homo sapiens (human): 3561Help
Entry
3561              CDS       T01001                                 

Gene name
IL2RG, CD132, CIDX, IL-2RG, IMD4, P64, SCIDX, SCIDX1
Definition
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05340  Primary immunodeficiency
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
Disease
H00091  T-B+Severe combined immunodeficiency
H00093  Combined immunodeficiency
Drug target
Aldesleukin: D00748
Celmoleukin: D02743
Teceleukin: D02749
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3561 (IL2RG)
   04151 PI3K-Akt signaling pathway
    3561 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3561 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3561 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3561 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3561 (IL2RG)
   04659 Th17 cell differentiation
    3561 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3561 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    3561 (IL2RG)
   05340 Primary immunodeficiency
    3561 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3561 (IL2RG)
   05162 Measles
    3561 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3561 (IL2RG)
   04090 CD molecules [BR:hsa04090]
    3561 (IL2RG)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3561 (IL2RG)
CD molecules [BR:hsa04090]
 Proteins
  3561 (IL2RG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3 IL4Ra_N
Motif
Other DBs
NCBI-GeneID: 3561
NCBI-ProteinID: NP_000197
OMIM: 308380
HGNC: 6010
Ensembl: ENSG00000147168
Vega: OTTHUMG00000021787
Pharos: P31785(Tclin)
UniProt: P31785
Structure
PDB: 

Position
Xq13.1
AA seq 369 aa AA seqDB search
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAP
PCYTLKPET
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagccatcattaccattcacatccctcttattcctgcagctgcccctgctggga
gtggggctgaacacgacaattctgacgcccaatgggaatgaagacaccacagctgatttc
ttcctgaccactatgcccactgactccctcagtgtttccactctgcccctcccagaggtt
cagtgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagccc
cagcctaccaacctcactctgcattattggtacaagaactcggataatgataaagtccag
aagtgcagccactatctattctctgaagaaatcacttctggctgtcagttgcaaaaaaag
gagatccacctctaccaaacatttgttgttcagctccaggacccacgggaacccaggaga
caggccacacagatgctaaaactgcagaatctggtgatcccctgggctccagagaaccta
acacttcacaaactgagtgaatcccagctagaactgaactggaacaacagattcttgaac
cactgtttggagcacttggtgcagtaccggactgactgggaccacagctggactgaacaa
tcagtggattatagacataagttctccttgcctagtgtggatgggcagaaacgctacacg
tttcgtgttcggagccgctttaacccactctgtggaagtgctcagcattggagtgaatgg
agccacccaatccactgggggagcaatacttcaaaagagaatcctttcctgtttgcattg
gaagccgtggttatctctgttggctccatgggattgattatcagccttctctgtgtgtat
ttctggctggaacggacgatgccccgaattcccaccctgaagaacctagaggatcttgtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagt
ctgcagccagactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggg
gcccttggggaggggcctggggcctccccatgcaaccagcatagcccctactgggccccc
ccatgttacaccctaaagcctgaaacctga

DBGET integrated database retrieval system