KEGG   Homo sapiens (human): 3566Help
Entry
3566              CDS       T01001                                 

Gene name
IL4R, CD124, IL-4RA, IL4RA
Definition
(RefSeq) interleukin 4 receptor
  KO
K05071  interleukin 4 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00079  Asthma
H01358  Atopic dermatitis
Drug target
Dupilumab: D10354
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3566 (IL4R)
   04151 PI3K-Akt signaling pathway
    3566 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3566 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3566 (IL4R)
   04658 Th1 and Th2 cell differentiation
    3566 (IL4R)
   04659 Th17 cell differentiation
    3566 (IL4R)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3566 (IL4R)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    3566 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3566 (IL4R)
   04090 CD molecules [BR:hsa04090]
    3566 (IL4R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3566 (IL4R)
CD molecules [BR:hsa04090]
 Proteins
  3566 (IL4R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL4Ra_N fn3
Motif
Other DBs
NCBI-GeneID: 3566
NCBI-ProteinID: NP_000409
OMIM: 147781
HGNC: 6015
Ensembl: ENSG00000077238
Vega: OTTHUMG00000097015
Pharos: P24394(Tbio)
UniProt: P24394
Structure
PDB: 

Position
16p12.1
AA seq 825 aa AA seqDB search
MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRL
LYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEH
VKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYL
EPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQHLLLGVSVS
CIVILAVCLLCYVSITKIKKEWWDQIPNPARSRLVAIIIQDAQGSQWEKRSRGQEPAKCP
HWKNCLTKLLPCFLEHNMKRDEDPHKAAKEMPFQGSGKSAWCPVEISKTVLWPESISVVR
CVELFEAPVECEEEEEVEEEKGSFCASPESSRDDFQEGREGIVARLTESLFLDLLGEENG
GFCQQDMGESCLLPPSGSTSAHMPWDEFPSAGPKEAPPWGKEQPLHLEPSPPASPTQSPD
NLTCTETPLVIAGNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVEPEMPCVPQLSEPT
TVPQPEPETWEQILRRNVLQHGAAAAPVSAPTSGYQEFVHAVEQGGTQASAVVGLGPPGE
AGYKAFSSLLASSAVSPEKCGFGASSGEEGYKPFQDLIPGCPGDPAPVPVPLFTFGLDRE
PPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVDSLGSGIVYSALTCHL
CGHLKQCHGQEDGGQTPVMASPCCGCCCGDRSSPPTTPLRAPDPSPGGVPLEASLCPASL
APSGISEKSKSSSSFHPAPGNAQSSSQTPKIVNFVSVGPTYMRVS
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atggggtggctttgctctgggctcctgttccctgtgagctgcctggtcctgctgcaggtg
gcaagctctgggaacatgaaggtcttgcaggagcccacctgcgtctccgactacatgagc
atctctacttgcgagtggaagatgaatggtcccaccaattgcagcaccgagctccgcctg
ttgtaccagctggtttttctgctctccgaagcccacacgtgtatccctgagaacaacgga
ggcgcggggtgcgtgtgccacctgctcatggatgacgtggtcagtgcggataactataca
ctggacctgtgggctgggcagcagctgctgtggaagggctccttcaagcccagcgagcat
gtgaaacccagggccccaggaaacctgacagttcacaccaatgtctccgacactctgctg
ctgacctggagcaacccgtatccccctgacaattacctgtataatcatctcacctatgca
gtcaacatttggagtgaaaacgacccggcagatttcagaatctataacgtgacctaccta
gaaccctccctccgcatcgcagccagcaccctgaagtctgggatttcctacagggcacgg
gtgagggcctgggctcagtgctataacaccacctggagtgagtggagccccagcaccaag
tggcacaactcctacagggagcccttcgagcagcacctcctgctgggcgtcagcgtttcc
tgcattgtcatcctggccgtctgcctgttgtgctatgtcagcatcaccaagattaagaaa
gaatggtgggatcagattcccaacccagcccgcagccgcctcgtggctataataatccag
gatgctcaggggtcacagtgggagaagcggtcccgaggccaggaaccagccaagtgccca
cactggaagaattgtcttaccaagctcttgccctgttttctggagcacaacatgaaaagg
gatgaagatcctcacaaggctgccaaagagatgcctttccagggctctggaaaatcagca
tggtgcccagtggagatcagcaagacagtcctctggccagagagcatcagcgtggtgcga
tgtgtggagttgtttgaggccccggtggagtgtgaggaggaggaggaggtagaggaagaa
aaagggagcttctgtgcatcgcctgagagcagcagggatgacttccaggagggaagggag
ggcattgtggcccggctaacagagagcctgttcctggacctgctcggagaggagaatggg
ggcttttgccagcaggacatgggggagtcatgccttcttccaccttcgggaagtacgagt
gctcacatgccctgggatgagttcccaagtgcagggcccaaggaggcacctccctggggc
aaggagcagcctctccacctggagccaagtcctcctgccagcccgacccagagtccagac
aacctgacttgcacagagacgcccctcgtcatcgcaggcaaccctgcttaccgcagcttc
agcaactccctgagccagtcaccgtgtcccagagagctgggtccagacccactgctggcc
agacacctggaggaagtagaacccgagatgccctgtgtcccccagctctctgagccaacc
actgtgccccaacctgagccagaaacctgggagcagatcctccgccgaaatgtcctccag
catggggcagctgcagcccccgtctcggcccccaccagtggctatcaggagtttgtacat
gcggtggagcagggtggcacccaggccagtgcggtggtgggcttgggtcccccaggagag
gctggttacaaggccttctcaagcctgcttgccagcagtgctgtgtccccagagaaatgt
gggtttggggctagcagtggggaagaggggtataagcctttccaagacctcattcctggc
tgccctggggaccctgccccagtccctgtccccttgttcacctttggactggacagggag
ccacctcgcagtccgcagagctcacatctcccaagcagctccccagagcacctgggtctg
gagccgggggaaaaggtagaggacatgccaaagcccccacttccccaggagcaggccaca
gacccccttgtggacagcctgggcagtggcattgtctactcagcccttacctgccacctg
tgcggccacctgaaacagtgtcatggccaggaggatggtggccagacccctgtcatggcc
agtccttgctgtggctgctgctgtggagacaggtcctcgccccctacaacccccctgagg
gccccagacccctctccaggtggggttccactggaggccagtctgtgtccggcctccctg
gcaccctcgggcatctcagagaagagtaaatcctcatcatccttccatcctgcccctggc
aatgctcagagctcaagccagacccccaaaatcgtgaactttgtctccgtgggacccaca
tacatgagggtctcttag

DBGET integrated database retrieval system