KEGG   Homo sapiens (human): 3567Help
Entry
3567              CDS       T01001                                 

Gene name
IL5, EDF, IL-5, TRF
Definition
(RefSeq) interleukin 5
  KO
K05428  interleukin 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05200  Pathways in cancer
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease (IBD)
hsa05330  Allograft rejection
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Drug target
Mepolizumab: D04923
Reslizumab: D08985
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3567 (IL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3567 (IL5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3567 (IL5)
   04660 T cell receptor signaling pathway
    3567 (IL5)
   04658 Th1 and Th2 cell differentiation
    3567 (IL5)
   04657 IL-17 signaling pathway
    3567 (IL5)
   04664 Fc epsilon RI signaling pathway
    3567 (IL5)
   04672 Intestinal immune network for IgA production
    3567 (IL5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3567 (IL5)
  09163 Immune disease
   05310 Asthma
    3567 (IL5)
   05320 Autoimmune thyroid disease
    3567 (IL5)
   05321 Inflammatory bowel disease (IBD)
    3567 (IL5)
   05330 Allograft rejection
    3567 (IL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3567 (IL5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3567 (IL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3567 (IL5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Cytokines
   3567 (IL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL5
Motif
Other DBs
NCBI-GeneID: 3567
NCBI-ProteinID: NP_000870
OMIM: 147850
HGNC: 6016
Ensembl: ENSG00000113525
Vega: OTTHUMG00000059496
Pharos: P05113(Tclin)
UniProt: P05113
Structure
PDB: 

Position
5q31.1
AA seq 134 aa AA seqDB search
MRMLLHLSLLALGAAYVYAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNH
QLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQ
EFLGVMNTEWIIES
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgcttctgcatttgagtttgctagctcttggagctgcctacgtgtatgccatc
cccacagaaattcccacaagtgcattggtgaaagagaccttggcactgctttctactcat
cgaactctgctgatagccaatgagactctgaggattcctgttcctgtacataaaaatcac
caactgtgcactgaagaaatctttcagggaataggcacactggagagtcaaactgtgcaa
gggggtactgtggaaagactattcaaaaacttgtccttaataaagaaatacattgacggc
caaaaaaaaaagtgtggagaagaaagacggagagtaaaccaattcctagactacctgcaa
gagtttcttggtgtaatgaacaccgagtggataatagaaagttga

DBGET integrated database retrieval system