KEGG   Homo sapiens (human): 3568Help
Entry
3568              CDS       T01001                                 

Gene name
IL5RA, CD125, CDw125, HSIL5R3, IL5R
Definition
(RefSeq) interleukin 5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
Drug target
Benralizumab: D09874
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3568 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3568 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3568 (IL5RA)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3568 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3568 (IL5RA)
   04090 CD molecules [BR:hsa04090]
    3568 (IL5RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   3568 (IL5RA)
CD molecules [BR:hsa04090]
 Proteins
  3568 (IL5RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind Tissue_fac
Motif
Other DBs
NCBI-GeneID: 3568
NCBI-ProteinID: NP_000555
OMIM: 147851
HGNC: 6017
Ensembl: ENSG00000091181
Vega: OTTHUMG00000090245
Pharos: Q01344(Tbio)
UniProt: Q01344 A0A024R2C8
Structure
PDB: 

Position
3p26.2
AA seq 420 aa AA seqDB search
MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA
PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQIN
PPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMATICFILLILSL
ICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgtggcgcatgtattactcatccttttgggggccactgagatactgcaagct
gacttacttcctgatgaaaagatttcacttctcccacctgtcaatttcaccattaaagtt
actggtttggctcaagttcttttacaatggaaaccaaatcctgatcaagagcaaaggaat
gttaatctagaatatcaagtgaaaataaacgctccaaaagaagatgactatgaaaccaga
atcactgaaagcaaatgtgtaaccatcctccacaaaggcttttcagcaagtgtgcggacc
atcctgcagaacgaccactcactactggccagcagctgggcttctgctgaacttcatgcc
ccaccagggtctcctggaacctcaattgtgaatttaacttgcaccacaaacactacagaa
gacaattattcacgtttaaggtcataccaagtttcccttcactgcacctggcttgttggc
acagatgcccctgaggacacgcagtattttctctactataggtatggctcttggactgaa
gaatgccaagaatacagcaaagacacactggggagaaatatcgcatgctggtttcccagg
acttttatcctcagcaaagggcgtgactggcttgcggtgcttgttaacggctccagcaag
cactctgctatcaggccctttgatcagctgtttgcccttcacgccattgatcaaataaat
cctccactgaatgtcacagcagagattgaaggaactcgtctctctatccaatgggagaaa
ccagtgtctgcttttccaatccattgctttgattatgaagtaaaaatacacaatacaagg
aatggatatttgcagatagaaaaattgatgaccaatgcattcatctcaataattgatgat
ctttctaagtacgatgttcaagtgagagcagcagtgagctccatgtgcagagaggcaggg
ctctggagtgagtggagccaacctatttatgtgggaaatgatgaacacaagcccttgaga
gagtggtttgtcattgtgattatggcaaccatctgcttcatcttgttaattctctcgctt
atctgtaaaatatgtcatttatggatcaagttgtttccaccaattccagcaccaaaaagt
aatatcaaagatctctttgtaaccactaactatgagaaagctgggtccagtgagacggaa
attgaagtcatctgttatatagagaagcctggagttgagaccctggaggattctgtgttt
tga

DBGET integrated database retrieval system