KEGG   Homo sapiens (human): 3568Help
Entry
3568              CDS       T01001                                 

Gene name
IL5RA, CD125, CDw125, HSIL5R3, IL5R
Definition
(RefSeq) interleukin 5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
Drug target
Benralizumab: D09874
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3568 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3568 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3568 (IL5RA)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    3568 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3568 (IL5RA)
   04090 CD Molecules [BR:hsa04090]
    3568 (IL5RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   3568 (IL5RA)
CD molecules [BR:hsa04090]
 Proteins
  3568 (IL5RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind Tissue_fac
Motif
Other DBs
NCBI-GeneID: 3568
NCBI-ProteinID: NP_000555
OMIM: 147851
HGNC: 6017
Ensembl: ENSG00000091181
Vega: OTTHUMG00000090245
Pharos: Q01344(Tbio)
UniProt: Q01344 A0A024R2C8
Structure
PDB: 

Position
3p26.2
AA seq 420 aa AA seqDB search
MIIVAHVLLILLGATEILQADLLPDEKISLLPPVNFTIKVTGLAQVLLQWKPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQNDHSLLASSWASAELHA
PPGSPGTSIVNLTCTTNTTEDNYSRLRSYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDTLGRNIACWFPRTFILSKGRDWLAVLVNGSSKHSAIRPFDQLFALHAIDQIN
PPLNVTAEIEGTRLSIQWEKPVSAFPIHCFDYEVKIHNTRNGYLQIEKLMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGNDEHKPLREWFVIVIMATICFILLILSL
ICKICHLWIKLFPPIPAPKSNIKDLFVTTNYEKAGSSETEIEVICYIEKPGVETLEDSVF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgtggcgcatgtattactcatccttttgggggccactgagatactgcaagct
gacttacttcctgatgaaaagatttcacttctcccacctgtcaatttcaccattaaagtt
actggtttggctcaagttcttttacaatggaaaccaaatcctgatcaagagcaaaggaat
gttaatctagaatatcaagtgaaaataaacgctccaaaagaagatgactatgaaaccaga
atcactgaaagcaaatgtgtaaccatcctccacaaaggcttttcagcaagtgtgcggacc
atcctgcagaacgaccactcactactggccagcagctgggcttctgctgaacttcatgcc
ccaccagggtctcctggaacctcaattgtgaatttaacttgcaccacaaacactacagaa
gacaattattcacgtttaaggtcataccaagtttcccttcactgcacctggcttgttggc
acagatgcccctgaggacacgcagtattttctctactataggtatggctcttggactgaa
gaatgccaagaatacagcaaagacacactggggagaaatatcgcatgctggtttcccagg
acttttatcctcagcaaagggcgtgactggcttgcggtgcttgttaacggctccagcaag
cactctgctatcaggccctttgatcagctgtttgcccttcacgccattgatcaaataaat
cctccactgaatgtcacagcagagattgaaggaactcgtctctctatccaatgggagaaa
ccagtgtctgcttttccaatccattgctttgattatgaagtaaaaatacacaatacaagg
aatggatatttgcagatagaaaaattgatgaccaatgcattcatctcaataattgatgat
ctttctaagtacgatgttcaagtgagagcagcagtgagctccatgtgcagagaggcaggg
ctctggagtgagtggagccaacctatttatgtgggaaatgatgaacacaagcccttgaga
gagtggtttgtcattgtgattatggcaaccatctgcttcatcttgttaattctctcgctt
atctgtaaaatatgtcatttatggatcaagttgtttccaccaattccagcaccaaaaagt
aatatcaaagatctctttgtaaccactaactatgagaaagctgggtccagtgagacggaa
attgaagtcatctgttatatagagaagcctggagttgagaccctggaggattctgtgttt
tga

DBGET integrated database retrieval system