KEGG   Homo sapiens (human): 3574Help
Entry
3574              CDS       T01001                                 

Gene name
IL7, IL-7
Definition
(RefSeq) interleukin 7
  KO
K05431  interleukin 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3574 (IL7)
   04151 PI3K-Akt signaling pathway
    3574 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3574 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3574 (IL7)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    3574 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3574 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3574 (IL7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3574 (IL7)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   3574 (IL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL7
Motif
Other DBs
NCBI-GeneID: 3574
NCBI-ProteinID: NP_000871
OMIM: 146660
HGNC: 6023
Ensembl: ENSG00000104432
Vega: OTTHUMG00000164620
Pharos: P13232(Tbio)
UniProt: P13232 A8K673
Structure
PDB: 

Position
8q21.13
AA seq 177 aa AA seqDB search
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCL
NNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQ
VKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggacttcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattgaaggtaaagatggcaaacaatatgagagtgtt
ctaatggtcagcatcgatcaattattggacagcatgaaagaaattggtagcaattgcctg
aataatgaatttaacttttttaaaagacatatctgtgatgctaataaggaaggtatgttt
ttattccgtgctgctcgcaagttgaggcaatttcttaaaatgaatagcactggtgatttt
gatctccacttattaaaagtttcagaaggcacaacaatactgttgaactgcactggccag
gttaaaggaagaaaaccagctgccctgggtgaagcccaaccaacaaagagtttggaagaa
aataaatctttaaaggaacagaaaaaactgaatgacttgtgtttcctaaagagactatta
caagagataaaaacttgttggaataaaattttgatgggcactaaagaacactga

DBGET integrated database retrieval system