KEGG   Homo sapiens (human): 3574Help
Entry
3574              CDS       T01001                                 

Gene name
IL7, IL-7
Definition
(RefSeq) interleukin 7
  KO
K05431  interleukin 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3574 (IL7)
   04151 PI3K-Akt signaling pathway
    3574 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3574 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3574 (IL7)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3574 (IL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3574 (IL7)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3574 (IL7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3574 (IL7)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   3574 (IL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL7
Motif
Other DBs
NCBI-GeneID: 3574
NCBI-ProteinID: NP_000871
OMIM: 146660
HGNC: 6023
Ensembl: ENSG00000104432
Vega: OTTHUMG00000164620
Pharos: P13232(Tbio)
UniProt: P13232 A8K673
Structure
PDB: 

Position
8q21.13
AA seq 177 aa AA seqDB search
MFHVSFRYIFGLPPLILVLLPVASSDCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCL
NNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQ
VKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggacttcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattgaaggtaaagatggcaaacaatatgagagtgtt
ctaatggtcagcatcgatcaattattggacagcatgaaagaaattggtagcaattgcctg
aataatgaatttaacttttttaaaagacatatctgtgatgctaataaggaaggtatgttt
ttattccgtgctgctcgcaagttgaggcaatttcttaaaatgaatagcactggtgatttt
gatctccacttattaaaagtttcagaaggcacaacaatactgttgaactgcactggccag
gttaaaggaagaaaaccagctgccctgggtgaagcccaaccaacaaagagtttggaagaa
aataaatctttaaaggaacagaaaaaactgaatgacttgtgtttcctaaagagactatta
caagagataaaaacttgttggaataaaattttgatgggcactaaagaacactga

DBGET integrated database retrieval system