KEGG   Homo sapiens (human): 3577Help
Entry
3577              CDS       T01001                                 

Gene name
CXCR1, C-C, C-C-CKR-1, CD128, CD181, CDw128a, CKR-1, CMKAR1, IL8R1, IL8RA, IL8RBA
Definition
(RefSeq) C-X-C motif chemokine receptor 1
  KO
K04175  C-X-C chemokine receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Drug target
Navarixin: D10075
Reparixin: D08984
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    3577 (CXCR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3577 (CXCR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3577 (CXCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    3577 (CXCR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3577 (CXCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3577 (CXCR1)
   04050 Cytokine receptors [BR:hsa04050]
    3577 (CXCR1)
   04090 CD molecules [BR:hsa04090]
    3577 (CXCR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    3577 (CXCR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   3577 (CXCR1)
CD molecules [BR:hsa04090]
 Proteins
  3577 (CXCR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 3577
NCBI-ProteinID: NP_000625
OMIM: 146929
HGNC: 6026
Ensembl: ENSG00000163464
Vega: OTTHUMG00000133108
Pharos: P25024(Tchem)
UniProt: P25024
Structure
PDB: 

Position
2q35
AA seq 350 aa AA seqDB search
MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatg
ccacctgcagatgaagattacagcccctgtatgctagaaactgagacactcaacaagtat
gttgtgatcatcgcctatgccctagtgttcctgctgagcctgctgggaaactccctggtg
atgctggtcatcttatacagcagggtcggccgctccgtcactgatgtctacctgctgaac
ctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtg
aatggctggatttttggcacattcctgtgcaaggtggtctcactcctgaaggaagtcaac
ttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtc
catgccacacgcacactgacccagaagcgtcacttggtcaagtttgtttgtcttggctgc
tggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatcca
aacaattccagtccagtttgctatgaggtcctgggaaatgacacagcaaaatggcggatg
gtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttc
tgctatggattcaccctgcgtacactgtttaaggcccacatggggcagaagcaccgagcc
atgagggtcatctttgctgtcgtcctcatcttcctgctttgctggctgccctacaacctg
gtcctgctggcagacaccctcatgaggacccaggtgatccaggagagctgtgagcgccgc
aacaacatcggccgggccctggatgccactgagattctgggatttctccatagctgcctc
aaccccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatcctg
gctatgcatggcctggtcagcaaggagttcttggcacgtcatcgtgttacctcctacact
tcttcgtctgtcaatgtctcttccaacctctga

DBGET integrated database retrieval system