KEGG   Homo sapiens (human): 3577
Entry
3577              CDS       T01001                                 

Symbol
CXCR1, C-C, C-C-CKR-1, CD128, CD181, CDw128a, CKR-1, CMKAR1, IL8R1, IL8RA, IL8RBA
Name
(RefSeq) C-X-C motif chemokine receptor 1
  KO
K04175  C-X-C chemokine receptor type 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01233  CXCL1/5/6/8 to CXCR1 signaling
N01236  MOCV1 MC148 to CXCR1 signaling
N01237  HCMV vCXCL1 to CXCR1 signaling
Drug target
Navarixin: D10075
Reparixin: D08984
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    3577 (CXCR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3577 (CXCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3577 (CXCR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3577 (CXCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    3577 (CXCR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3577 (CXCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3577 (CXCR1)
   04050 Cytokine receptors [BR:hsa04050]
    3577 (CXCR1)
   04090 CD molecules [BR:hsa04090]
    3577 (CXCR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    3577 (CXCR1)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   3577 (CXCR1)
CD molecules [BR:hsa04090]
 Proteins
  3577 (CXCR1)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 3577
NCBI-ProteinID: NP_000625
OMIM: 146929
HGNC: 6026
Ensembl: ENSG00000163464
Vega: OTTHUMG00000133108
Pharos: P25024(Tchem)
UniProt: P25024
Structure
PDB: 
2LNL

Position
2q35
AA seq 350 aa
MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgtcaaatattacagatccacagatgtgggattttgatgatctaaatttcactggcatg
ccacctgcagatgaagattacagcccctgtatgctagaaactgagacactcaacaagtat
gttgtgatcatcgcctatgccctagtgttcctgctgagcctgctgggaaactccctggtg
atgctggtcatcttatacagcagggtcggccgctccgtcactgatgtctacctgctgaac
ctggccttggccgacctactctttgccctgaccttgcccatctgggccgcctccaaggtg
aatggctggatttttggcacattcctgtgcaaggtggtctcactcctgaaggaagtcaac
ttctacagtggcatcctgctgttggcctgcatcagtgtggaccgttacctggccattgtc
catgccacacgcacactgacccagaagcgtcacttggtcaagtttgtttgtcttggctgc
tggggactgtctatgaatctgtccctgcccttcttccttttccgccaggcttaccatcca
aacaattccagtccagtttgctatgaggtcctgggaaatgacacagcaaaatggcggatg
gtgttgcggatcctgcctcacacctttggcttcatcgtgccgctgtttgtcatgctgttc
tgctatggattcaccctgcgtacactgtttaaggcccacatggggcagaagcaccgagcc
atgagggtcatctttgctgtcgtcctcatcttcctgctttgctggctgccctacaacctg
gtcctgctggcagacaccctcatgaggacccaggtgatccaggagagctgtgagcgccgc
aacaacatcggccgggccctggatgccactgagattctgggatttctccatagctgcctc
aaccccatcatctacgccttcatcggccaaaattttcgccatggattcctcaagatcctg
gctatgcatggcctggtcagcaaggagttcttggcacgtcatcgtgttacctcctacact
tcttcgtctgtcaatgtctcttccaacctctga

KEGG   Homo sapiens (human): 3579
Entry
3579              CDS       T01001                                 

Symbol
CXCR2, CD182, CDw128b, CMKAR2, IL8R2, IL8RA, IL8RB, WHIMS2
Name
(RefSeq) C-X-C motif chemokine receptor 2
  KO
K05050  C-X-C chemokine receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05163  Human cytomegalovirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06224  CXCR signaling
  Element
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00427  HCMV vCXCL to CXCR-GNB/G-PI3K-AKT signaling pathway
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
N01240  MOCV1 MC148 to CXCR2 signaling
Drug target
Danirixin: D10387
Elubrixin (DG01371): D10332 D10420
Navarixin: D10075
Reparixin: D08984
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    3579 (CXCR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3579 (CXCR2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3579 (CXCR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3579 (CXCR2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    3579 (CXCR2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    3579 (CXCR2)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3579 (CXCR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3579 (CXCR2)
   04050 Cytokine receptors [BR:hsa04050]
    3579 (CXCR2)
   04090 CD molecules [BR:hsa04090]
    3579 (CXCR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    3579 (CXCR2)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   3579 (CXCR2)
CD molecules [BR:hsa04090]
 Proteins
  3579 (CXCR2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 3579
NCBI-ProteinID: NP_001161770
OMIM: 146928
HGNC: 6027
Ensembl: ENSG00000180871
Vega: OTTHUMG00000133107
Pharos: P25025(Tchem)
UniProt: P25025 Q53PC4
Position
2q35
AA seq 360 aa
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggaagattttaacatggagagtgacagctttgaagatttctggaaaggtgaagatctt
agtaattacagttacagctctaccctgcccccttttctactagatgccgccccatgtgaa
ccagaatccctggaaatcaacaagtattttgtggtcattatctatgccctggtattcctg
ctgagcctgctgggaaactccctcgtgatgctggtcatcttatacagcagggtcggccgc
tccgtcactgatgtctacctgctgaacctagccttggccgacctactctttgccctgacc
ttgcccatctgggccgcctccaaggtgaatggctggatttttggcacattcctgtgcaag
gtggtctcactcctgaaggaagtcaacttctatagtggcatcctgctactggcctgcatc
agtgtggaccgttacctggccattgtccatgccacacgcacactgacccagaagcgctac
ttggtcaaattcatatgtctcagcatctggggtctgtccttgctcctggccctgcctgtc
ttacttttccgaaggaccgtctactcatccaatgttagcccagcctgctatgaggacatg
ggcaacaatacagcaaactggcggatgctgttacggatcctgccccagtcctttggcttc
atcgtgccactgctgatcatgctgttctgctacggattcaccctgcgtacgctgtttaag
gcccacatggggcagaagcaccgggccatgcgggtcatctttgctgtcgtcctcatcttc
ctgctctgctggctgccctacaacctggtcctgctggcagacaccctcatgaggacccag
gtgatccaggagacctgtgagcgccgcaatcacatcgaccgggctctggatgccaccgag
attctgggcatccttcacagctgcctcaaccccctcatctacgccttcattggccagaag
tttcgccatggactcctcaagattctagctatacatggcttgatcagcaaggactccctg
cccaaagacagcaggccttcctttgttggctcttcttcagggcacacttccactactctc
taa

DBGET integrated database retrieval system