KEGG   Homo sapiens (human): 3578Help
Entry
3578              CDS       T01001                                 

Gene name
IL9, HP40, IL-9, P40
Definition
(RefSeq) interleukin 9
  KO
K05432  interleukin 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa05310  Asthma
Drug target
Enokizumab: D09897
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3578 (IL9)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3578 (IL9)
 Human Diseases
  Immune diseases
   05310 Asthma
    3578 (IL9)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3578 (IL9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL7
Motif
Other DBs
NCBI-GeneID: 3578
NCBI-ProteinID: NP_000581
OMIM: 146931
HGNC: 6029
Ensembl: ENSG00000145839
Vega: OTTHUMG00000129147
Pharos: P15248(Tbio)
UniProt: P15248
Position
5q31.1
AA seq 144 aa AA seqDB search
MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIP
SDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGN
ALTFLKSLLEIFQKEKMRGMRGKI
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggccatggtccttacctctgccctgctcctgtgctccgtggcaggccagggg
tgtccaaccttggcggggatcctggacatcaacttcctcatcaacaagatgcaggaagat
ccagcttccaagtgccactgcagtgctaatgtgaccagttgtctctgtttgggcattccc
tctgacaactgcaccagaccatgcttcagtgagagactgtctcagatgaccaataccacc
atgcaaacaagatacccactgattttcagtcgggtgaaaaaatcagttgaagtactaaag
aacaacaagtgtccatatttttcctgtgaacagccatgcaaccaaaccacggcaggcaac
gcgctgacatttctgaagagtcttctggaaattttccagaaagaaaagatgagagggatg
agaggcaagatatga

DBGET integrated database retrieval system