KEGG   Homo sapiens (human): 3579Help
Entry
3579              CDS       T01001                                 

Gene name
CXCR2, CD182, CDw128b, CMKAR2, IL8R2, IL8RA, IL8RB
Definition
(RefSeq) C-X-C motif chemokine receptor 2
  KO
K05050  C-X-C chemokine receptor type 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04144  Endocytosis
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
Network
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CXCR-GNB/G-PI3K-JNK signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
Drug target
Danirixin: D10387
Elubrixin (DG01371): D10332 D10420
Navarixin: D10075
Reparixin: D08984
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    3579 (CXCR2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3579 (CXCR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    3579 (CXCR2)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    3579 (CXCR2)
 Human Diseases
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3579 (CXCR2)
   05163 Human cytomegalovirus infection
    3579 (CXCR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemokine
   CXC Chemokine
    3579 (CXCR2)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   3579 (CXCR2)
CD molecules [BR:hsa04090]
 Proteins
  3579 (CXCR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 3579
NCBI-ProteinID: NP_001161770
OMIM: 146928
HGNC: 6027
Ensembl: ENSG00000180871
Vega: OTTHUMG00000133107
Pharos: P25025(Tchem)
UniProt: P25025 Q53PC4
Position
2q35
AA seq 360 aa AA seqDB search
MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaagattttaacatggagagtgacagctttgaagatttctggaaaggtgaagatctt
agtaattacagttacagctctaccctgcccccttttctactagatgccgccccatgtgaa
ccagaatccctggaaatcaacaagtattttgtggtcattatctatgccctggtattcctg
ctgagcctgctgggaaactccctcgtgatgctggtcatcttatacagcagggtcggccgc
tccgtcactgatgtctacctgctgaacctagccttggccgacctactctttgccctgacc
ttgcccatctgggccgcctccaaggtgaatggctggatttttggcacattcctgtgcaag
gtggtctcactcctgaaggaagtcaacttctatagtggcatcctgctactggcctgcatc
agtgtggaccgttacctggccattgtccatgccacacgcacactgacccagaagcgctac
ttggtcaaattcatatgtctcagcatctggggtctgtccttgctcctggccctgcctgtc
ttacttttccgaaggaccgtctactcatccaatgttagcccagcctgctatgaggacatg
ggcaacaatacagcaaactggcggatgctgttacggatcctgccccagtcctttggcttc
atcgtgccactgctgatcatgctgttctgctacggattcaccctgcgtacgctgtttaag
gcccacatggggcagaagcaccgggccatgcgggtcatctttgctgtcgtcctcatcttc
ctgctctgctggctgccctacaacctggtcctgctggcagacaccctcatgaggacccag
gtgatccaggagacctgtgagcgccgcaatcacatcgaccgggctctggatgccaccgag
attctgggcatccttcacagctgcctcaaccccctcatctacgccttcattggccagaag
tttcgccatggactcctcaagattctagctatacatggcttgatcagcaaggactccctg
cccaaagacagcaggccttcctttgttggctcttcttcagggcacacttccactactctc
taa

DBGET integrated database retrieval system