KEGG   Homo sapiens (human): 3587Help
Entry
3587              CDS       T01001                                 

Gene name
IL10RA, CD210, CD210a, CDW210A, HIL-10R, IL-10R1, IL10R
Definition
(RefSeq) interleukin 10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
hsa05169  Epstein-Barr virus infection
Network
N00415  IL10-Jak-STAT signaling pathway
N00416  HCMV cmvIL10 to IL10-JAK-STAT signaling pathway
Disease
H00286  Crohn disease
H01227  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3587 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3587 (IL10RA)
 09160 Human Diseases
  09167 Infectious diseases
   05152 Tuberculosis
    3587 (IL10RA)
   05163 Human cytomegalovirus infection
    3587 (IL10RA)
   05169 Epstein-Barr virus infection
    3587 (IL10RA)
   05145 Toxoplasmosis
    3587 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3587 (IL10RA)
   04090 CD Molecules [BR:hsa04090]
    3587 (IL10RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL10/28 receptor family
   3587 (IL10RA)
CD molecules [BR:hsa04090]
 Proteins
  3587 (IL10RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tissue_fac Interfer-bind
Motif
Other DBs
NCBI-GeneID: 3587
NCBI-ProteinID: NP_001549
OMIM: 146933
HGNC: 5964
Ensembl: ENSG00000110324
Vega: OTTHUMG00000166523
Pharos: Q13651(Tbio)
UniProt: Q13651
Structure
PDB: 

Position
11q23.3
AA seq 578 aa AA seqDB search
MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVA
LLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSV
DEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTF
THKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLTRQYFTVTNVIIFF
AFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEA
FLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSC
SSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGS
ALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRC
LVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWS
FAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgctgccgtgcctcgtagtgctgctggcggcgctcctcagcctccgtcttggctcagac
gctcatgggacagagctgcccagccctccgtctgtgtggtttgaagcagaatttttccac
cacatcctccactggacacccatcccaaatcagtctgaaagtacctgctatgaagtggcg
ctcctgaggtatggaatagagtcctggaactccatctccaactgtagccagaccctgtcc
tatgaccttaccgcagtgaccttggacctgtaccacagcaatggctaccgggccagagtg
cgggctgtggacggcagccggcactccaactggaccgtcaccaacacccgcttctctgtg
gatgaagtgactctgacagttggcagtgtgaacctagagatccacaatggcttcatcctc
gggaagattcagctacccaggcccaagatggcccccgcaaatgacacatatgaaagcatc
ttcagtcacttccgagagtatgagattgccattcgcaaggtgccgggaaacttcacgttc
acacacaagaaagtaaaacatgaaaacttcagcctcctaacctctggagaagtgggagag
ttctgtgtccaggtgaaaccatctgtcgcttcccgaagtaacaaggggatgtggtctaaa
gaggagtgcatctccctcaccaggcagtatttcaccgtgaccaacgtcatcatcttcttt
gcctttgtcctgctgctctccggagccctcgcctactgcctggccctccagctgtatgtg
cggcgccgaaagaagctacccagtgtcctgctcttcaagaagcccagccccttcatcttc
atcagccagcgtccctccccagagacccaagacaccatccacccgcttgatgaggaggcc
tttttgaaggtgtccccagagctgaagaacttggacctgcacggcagcacagacagtggc
tttggcagcaccaagccatccctgcagactgaagagccccagttcctcctccctgaccct
cacccccaggctgacagaacgctgggaaacagggagccccctgtgctgggggacagctgc
agtagtggcagcagcaatagcacagacagcgggatctgcctgcaggagcccagcctgagc
cccagcacagggcccacctgggagcaacaggtggggagcaacagcaggggccaggatgac
agtggcattgacttagttcaaaactctgagggccgggctggggacacacagggtggctcg
gccttgggccaccacagtcccccggagcctgaggtgcctggggaagaagacccagctgct
gtggcattccagggttacctgaggcagaccagatgtgctgaagagaaggcaaccaagaca
ggctgcctggaggaagaatcgcccttgacagatggccttggccccaaattcgggagatgc
ctggttgatgaggcaggcttgcatccaccagccctggccaagggctatttgaaacaggat
cctctagaaatgactctggcttcctcaggggccccaacgggacagtggaaccagcccact
gaggaatggtcactcctggccttgagcagctgcagtgacctgggaatatctgactggagc
tttgcccatgaccttgcccctctaggctgtgtggcagccccaggtggtctcctgggcagc
tttaactcagacctggtcaccctgcccctcatctctagcctgcagtcaagtgagtga

DBGET integrated database retrieval system