KEGG   Homo sapiens (human): 3588Help
Entry
3588              CDS       T01001                                 

Gene name
IL10RB, CDW210B, CRF2-4, CRFB4, D21S58, D21S66, IL-10R2
Definition
(RefSeq) interleukin 10 receptor subunit beta
  KO
K05135  interleukin 10 receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05163  Human cytomegalovirus infection
Network
N00415  IL10-Jak-STAT signaling pathway
N00416  HCMV IL10 to IL10-JAK-STAT signaling pathway
Disease
H00286  Crohn disease
H01227  Inflammatory bowel disease (IBD)
Drug target
Ilodecakin: D04505
Pegilodecakin: D11200
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3588 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3588 (IL10RB)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    3588 (IL10RB)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    3588 (IL10RB)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    3588 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3588 (IL10RB)
   04090 CD molecules [BR:hsa04090]
    3588 (IL10RB)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL10/28 receptor family
   3588 (IL10RB)
CD molecules [BR:hsa04090]
 Proteins
  3588 (IL10RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interfer-bind Tissue_fac fn3 DUF1201
Motif
Other DBs
NCBI-GeneID: 3588
NCBI-ProteinID: NP_000619
OMIM: 123889
HGNC: 5965
Ensembl: ENSG00000243646
Vega: OTTHUMG00000065128
Pharos: Q08334(Tbio)
UniProt: Q08334
Structure
PDB: 

Position
21q22.11
AA seq 325 aa AA seqDB search
MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYR
IFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQV
EVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRN
LEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLG
CFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAE
DSESGKQNPGDSCSLGTPPGQGPQS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggagccttgggagctggctgggtggctgcctgctggtgtcagcattgggaatg
gtaccacctcccgaaaatgtcagaatgaattctgttaatttcaagaacattctacagtgg
gagtcacctgcttttgccaaagggaacctgactttcacagctcagtacctaagttatagg
atattccaagataaatgcatgaatactaccttgacggaatgtgatttctcaagtctttcc
aagtatggtgaccacaccttgagagtcagggctgaatttgcagatgagcattcagactgg
gtaaacatcaccttctgtcctgtggatgacaccattattggaccccctggaatgcaagta
gaagtacttgctgattctttacatatgcgtttcttagcccctaaaattgagaatgaatac
gaaacttggactatgaagaatgtgtataactcatggacttataatgtgcaatactggaaa
aacggtactgatgaaaagtttcaaattactccccagtatgactttgaggtcctcagaaac
ctggagccatggacaacttattgtgttcaagttcgagggtttcttcctgatcggaacaaa
gctggggaatggagtgagcctgtctgtgagcaaacaacccatgacgaaacggtcccctcc
tggatggtggccgtcatcctcatggcctcggtcttcatggtctgcctggcactcctcggc
tgcttcgccttgctgtggtgcgtttacaagaagacaaagtacgccttctcccctaggaat
tctcttccacagcacctgaaagagtttttgggccatcctcatcataacacacttctgttt
ttctcctttccattgtcggatgagaatgatgtttttgacaagctaagtgtcattgcagaa
gactctgagagcggcaagcagaatcctggtgacagctgcagcctcgggaccccgcctggg
caggggccccaaagctag

DBGET integrated database retrieval system