KEGG   Homo sapiens (human): 3589Help
Entry
3589              CDS       T01001                                 

Gene name
IL11, AGIF, IL-11
Definition
(RefSeq) interleukin 11
  KO
K05417  interleukin 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3589 (IL11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3589 (IL11)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3589 (IL11)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    3589 (IL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3589 (IL11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3589 (IL11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL11
Motif
Other DBs
NCBI-GeneID: 3589
NCBI-ProteinID: NP_000632
OMIM: 147681
HGNC: 5966
Ensembl: ENSG00000095752
Vega: OTTHUMG00000180789
Pharos: P20809(Tbio)
UniProt: P20809 A8K3F7
Structure
PDB: 

Position
19q13.42
AA seq 199 aa AA seqDB search
MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQL
RDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLK
TLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGG
LHLTLDWAVRGLLLLKTRL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtgtttgccgcctggtcctggtcgtgctgagcctgtggccagatacagctgtc
gcccctgggccaccacctggcccccctcgagtttccccagaccctcgggccgagctggac
agcaccgtgctcctgacccgctctctcctggcggacacgcggcagctggctgcacagctg
agggacaaattcccagctgacggggaccacaacctggattccctgcccaccctggccatg
agtgcgggggcactgggagctctacagctcccaggtgtgctgacaaggctgcgagcggac
ctactgtcctacctgcggcacgtgcagtggctgcgccgggcaggtggctcttccctgaag
accctggagcccgagctgggcaccctgcaggcccgactggaccggctgctgcgccggctg
cagctcctgatgtcccgcctggccctgccccagccacccccggacccgccggcgcccccg
ctggcgcccccctcctcagcctgggggggcatcagggccgcccacgccatcctggggggg
ctgcacctgacacttgactgggccgtgaggggactgctgctgctgaagactcggctgtga

DBGET integrated database retrieval system