KEGG   Homo sapiens (human): 3592Help
Entry
3592              CDS       T01001                                 

Gene name
IL12A, CLMF, IL-12A, NFSK, NKSF1, P35
Definition
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04620  Toll-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04940  Type I diabetes mellitus
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05330  Allograft rejection
Network
N00053  Cytokine-Jak-STAT signaling pathway
N00435  TLR2/4-NFKB signaling pathway
Drug target
Apilimod mesylate: D06556
Briakinumab: D09588
Lisofylline: D04748
Ustekinumab: D09214
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3592 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3592 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3592 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    3592 (IL12A)
   04625 C-type lectin receptor signaling pathway
    3592 (IL12A)
   04658 Th1 and Th2 cell differentiation
    3592 (IL12A)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3592 (IL12A)
  09163 Immune diseases
   05321 Inflammatory bowel disease (IBD)
    3592 (IL12A)
   05330 Allograft rejection
    3592 (IL12A)
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3592 (IL12A)
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    3592 (IL12A)
   05134 Legionellosis
    3592 (IL12A)
   05152 Tuberculosis
    3592 (IL12A)
  09172 Infectious diseases: Viral
   05162 Measles
    3592 (IL12A)
   05164 Influenza A
    3592 (IL12A)
   05168 Herpes simplex infection
    3592 (IL12A)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    3592 (IL12A)
   05144 Malaria
    3592 (IL12A)
   05145 Toxoplasmosis
    3592 (IL12A)
   05140 Leishmaniasis
    3592 (IL12A)
   05142 Chagas disease (American trypanosomiasis)
    3592 (IL12A)
   05143 African trypanosomiasis
    3592 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3592 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3592 (IL12A)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3592 (IL12A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   3592 (IL12A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL12
Motif
Other DBs
NCBI-GeneID: 3592
NCBI-ProteinID: NP_000873
OMIM: 161560
HGNC: 5969
Ensembl: ENSG00000168811
Vega: OTTHUMG00000158942
Pharos: P29459(Tclin)
UniProt: P29459 O60595
Structure
PDB: 

Position
3q25.33
AA seq 253 aa AA seqDB search
MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLP
VATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACL
PLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLL
MDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA
VTIDRVMSYLNAS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgtggccccctgggtcagcctcccagccaccgccctcacctgccgcggccacaggtctg
catccagcggctcgccctgtgtccctgcagtgccggctcagcatgtgtccagcgcgcagc
ctcctccttgtggctaccctggtcctcctggaccacctcagtttggccagaaacctcccc
gtggccactccagacccaggaatgttcccatgccttcaccactcccaaaacctgctgagg
gccgtcagcaacatgctccagaaggccagacaaactctagaattttacccttgcacttct
gaagagattgatcatgaagatatcacaaaagataaaaccagcacagtggaggcctgttta
ccattggaattaaccaagaatgagagttgcctaaattccagagagacctctttcataact
aatgggagttgcctggcctccagaaagacctcttttatgatggccctgtgccttagtagt
atttatgaagacttgaagatgtaccaggtggagttcaagaccatgaatgcaaagcttctg
atggatcctaagaggcagatctttctagatcaaaacatgctggcagttattgatgagctg
atgcaggccctgaatttcaacagtgagactgtgccacaaaaatcctcccttgaagaaccg
gatttttataaaactaaaatcaagctctgcatacttcttcatgctttcagaattcgggca
gtgactattgatagagtgatgagctatctgaatgcttcctaa

DBGET integrated database retrieval system