KEGG   Homo sapiens (human): 3593Help
Entry
3593              CDS       T01001                                 

Gene name
IL12B, CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2
Definition
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04620  Toll-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04940  Type I diabetes mellitus
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05330  Allograft rejection
Network
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00089  IFN-gamma/IL-12 axis
Drug target
Apilimod mesylate: D06556
Briakinumab: D09588
Lisofylline: D04748
Ustekinumab: D09214
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3593 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3593 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3593 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    3593 (IL12B)
   04625 C-type lectin receptor signaling pathway
    3593 (IL12B)
   04658 Th1 and Th2 cell differentiation
    3593 (IL12B)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    3593 (IL12B)
   05205 Proteoglycans in cancer
    3593 (IL12B)
  09162 Immune diseases
   05321 Inflammatiory bowel disease (IBD)
    3593 (IL12B)
   05330 Allograft rejection
    3593 (IL12B)
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    3593 (IL12B)
  09167 Infectious diseases
   05133 Pertussis
    3593 (IL12B)
   05134 Legionellosis
    3593 (IL12B)
   05152 Tuberculosis
    3593 (IL12B)
   05162 Measles
    3593 (IL12B)
   05164 Influenza A
    3593 (IL12B)
   05168 Herpes simplex infection
    3593 (IL12B)
   05146 Amoebiasis
    3593 (IL12B)
   05145 Toxoplasmosis
    3593 (IL12B)
   05140 Leishmaniasis
    3593 (IL12B)
   05142 Chagas disease (American trypanosomiasis)
    3593 (IL12B)
   05143 African trypanosomiasis
    3593 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3593 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3593 (IL12B)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3593 (IL12B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   3593 (IL12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL12p40_C Ig_3 Ig_5 Ig_2 fn3 Ig_4 I-set
Motif
Other DBs
NCBI-GeneID: 3593
NCBI-ProteinID: NP_002178
OMIM: 161561
HGNC: 5970
Ensembl: ENSG00000113302
Vega: OTTHUMG00000130307
Pharos: P29460(Tclin)
UniProt: P29460
Structure
PDB: 

Position
5q33.3
AA seq 328 aa AA seqDB search
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
RKNASISVRAQDRYYSSSWSEWASVPCS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcaccagcagttggtcatctcttggttttccctggtttttctggcatctcccctc
gtggccatatgggaactgaagaaagatgtttatgtcgtagaattggattggtatccggat
gcccctggagaaatggtggtcctcacctgtgacacccctgaagaagatggtatcacctgg
accttggaccagagcagtgaggtcttaggctctggcaaaaccctgaccatccaagtcaaa
gagtttggagatgctggccagtacacctgtcacaaaggaggcgaggttctaagccattcg
ctcctgctgcttcacaaaaaggaagatggaatttggtccactgatattttaaaggaccag
aaagaacccaaaaataagacctttctaagatgcgaggccaagaattattctggacgtttc
acctgctggtggctgacgacaatcagtactgatttgacattcagtgtcaaaagcagcaga
ggctcttctgacccccaaggggtgacgtgcggagctgctacactctctgcagagagagtc
agaggggacaacaaggagtatgagtactcagtggagtgccaggaggacagtgcctgccca
gctgctgaggagagtctgcccattgaggtcatggtggatgccgttcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaaacctgacccacccaagaac
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acctggagtactccacattcctacttctccctgacattctgcgttcaggtccagggcaag
agcaagagagaaaagaaagatagagtcttcacggacaagacctcagccacggtcatctgc
cgcaaaaatgccagcattagcgtgcgggcccaggaccgctactatagctcatcttggagc
gaatgggcatctgtgccctgcagttag

DBGET integrated database retrieval system