KEGG   Homo sapiens (human): 3594Help
Entry
3594              CDS       T01001                                 

Gene name
IL12RB1, CD212, IL-12R-BETA1, IL12RB, IMD30
Definition
(RefSeq) interleukin 12 receptor subunit beta 1
  KO
K05063  interleukin 12 receptor beta-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00089  IFN-gamma/IL-12 axis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3594 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3594 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3594 (IL12RB1)
   04659 Th17 cell differentiation
    3594 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3594 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    3594 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3594 (IL12RB1)
   04090 CD molecules [BR:hsa04090]
    3594 (IL12RB1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL6/12 receptor family
   3594 (IL12RB1)
CD molecules [BR:hsa04090]
 Proteins
  3594 (IL12RB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Pur_ac_phosph_N
Motif
Other DBs
NCBI-GeneID: 3594
NCBI-ProteinID: NP_005526
OMIM: 601604
HGNC: 5971
Ensembl: ENSG00000096996
Vega: OTTHUMG00000183417
Pharos: P42701(Tbio)
UniProt: P42701
Position
19p13.11
AA seq 662 aa AA seqDB search
MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRY
ECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWAR
NQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSP
WKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQ
VRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEVTYRLQLHMLSCPCKAKATRT
LHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVGTNGTTMYWPA
RAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA
SAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKE
YVVRCRDEDSKQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIE
VQVSDWLIFFASLGSFLSILLVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQ
WINPVDFQEEASLQEALVVEMSWDKGERTEPLEKTELPEGAPELALDTELSLEDGDRCKA
KM
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggagccgctggtgacctgggtggtccccctcctcttcctcttcctgctgtccaggcag
ggcgctgcctgcagaaccagtgagtgctgttttcaggacccgccatatccggatgcagac
tcaggctcggcctcgggccctagggacctgagatgctatcggatatccagtgatcgttac
gagtgctcctggcagtatgagggtcccacagctggggtcagccacttcctgcggtgttgc
cttagctccgggcgctgctgctacttcgccgccggctcagccaccaggctgcagttctcc
gaccaggctggggtgtctgtgctgtacactgtcacactctgggtggaatcctgggccagg
aaccagacagagaagtctcctgaggtgaccctgcagctctacaactcagttaaatatgag
cctcctctgggagacatcaaggtgtccaagttggccgggcagctgcgtatggagtgggag
accccggataaccaggttggtgctgaggtgcagttccggcaccggacacccagcagccca
tggaagttgggcgactgcggacctcaggatgatgatactgagtcctgcctctgccccctg
gagatgaatgtggcccaggaattccagctccgacgacggcagctggggagccaaggaagt
tcctggagcaagtggagcagccccgtgtgcgttccccctgaaaaccccccacagcctcag
gtgagattctcggtggagcagctgggccaggatgggaggaggcggctgaccctgaaagag
cagccaacccagctggagcttccagaaggctgtcaagggctggcgcctggcacggaggtc
acttaccgactacagctccacatgctgtcctgcccgtgtaaggccaaggccaccaggacc
ctgcacctggggaagatgccctatctctcgggtgctgcctacaacgtggctgtcatctcc
tcgaaccaatttggtcctggcctgaaccagacgtggcacattcctgccgacacccacaca
gaaccagtggctctgaatatcagcgtcggaaccaacgggaccaccatgtattggccagcc
cgggctcagagcatgacgtattgcattgaatggcagcctgtgggccaggacgggggcctt
gccacctgcagcctgactgcgccgcaagacccggatccggctggaatggcaacctacagc
tggagtcgagagtctggggcaatggggcaggaaaagtgttactacattaccatctttgcc
tctgcgcaccccgagaagctcaccttgtggtctacggtcctgtccacctaccactttggg
ggcaatgcctcagcagctgggacaccgcaccacgtctcggtgaagaatcatagcttggac
tctgtgtctgtggactgggcaccatccctgctgagcacctgtcccggcgtcctaaaggag
tatgttgtccgctgccgagatgaagacagcaaacaggtgtcagagcatcccgtgcagccc
acagagacccaagttaccctcagtggcctgcgggctggtgtagcctacacggtgcaggtg
cgagcagacacagcgtggctgaggggtgtctggagccagccccagcgcttcagcatcgaa
gtgcaggtttctgattggctcatcttcttcgcctccctggggagcttcctgagcatcctt
ctcgtgggcgtccttggctaccttggcctgaacagggccgcacggcacctgtgcccgccg
ctgcccacaccctgtgccagctccgccattgagttccctggagggaaggagacttggcag
tggatcaacccagtggacttccaggaagaggcatccctgcaggaggccctggtggtagag
atgtcctgggacaaaggcgagaggactgagcctctcgagaagacagagctacctgagggt
gcccctgagctggccctggatacagagttgtccttggaggatggagacaggtgcaaggcc
aagatgtga

DBGET integrated database retrieval system