KEGG   Homo sapiens (human): 3597Help
Entry
3597              CDS       T01001                                 

Gene name
IL13RA1, CD213A1, CT19, IL-13Ra, NR4
Definition
(RefSeq) interleukin 13 receptor subunit alpha 1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa05200  Pathways in cancer
Network
N00053  Cytokine-Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    3597 (IL13RA1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3597 (IL13RA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    3597 (IL13RA1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL3 receptor family
   3597 (IL13RA1)
CD molecules [BR:hsa04090]
 Proteins
  3597 (IL13RA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind fn3 Tissue_fac EpoR_lig-bind
Motif
Other DBs
NCBI-GeneID: 3597
NCBI-ProteinID: NP_001551
OMIM: 300119
HGNC: 5974
Ensembl: ENSG00000131724
Vega: OTTHUMG00000022258
Pharos: P78552(Tbio)
UniProt: P78552
Structure
PDB: 

Position
Xq24
AA seq 427 aa AA seqDB search
MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASS
NCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISP
PEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREG
QYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHN
DDLYVQWENPQNFISRCLFYEVEVNNSQTETHNVFYVQEAKCENPEFERNVENTSCFMVP
GVLPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNSTLYITMLLIVPVIVAGAI
IVLLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIE
NLKKASQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggagtggccggcgcggctctgcgggctgtgggcgctgctgctctgcgccggcggcggg
ggcgggggcgggggcgccgcgcctacggaaactcagccacctgtgacaaatttgagtgtc
tctgttgaaaacctctgcacagtaatatggacatggaatccacccgagggagccagctca
aattgtagtctatggtattttagtcattttggcgacaaacaagataagaaaatagctccg
gaaactcgtcgttcaatagaagtacccctgaatgagaggatttgtctgcaagtggggtcc
cagtgtagcaccaatgagagtgagaagcctagcattttggttgaaaaatgcatctcaccc
ccagaaggtgatcctgagtctgctgtgactgagcttcaatgcatttggcacaacctgagc
tacatgaagtgttcttggctccctggaaggaataccagtcccgacactaactatactctc
tactattggcacagaagcctggaaaaaattcatcaatgtgaaaacatctttagagaaggc
caatactttggttgttcctttgatctgaccaaagtgaaggattccagttttgaacaacac
agtgtccaaataatggtcaaggataatgcaggaaaaattaaaccatccttcaatatagtg
cctttaacttcccgtgtgaaacctgatcctccacatattaaaaacctctccttccacaat
gatgacctatatgtgcaatgggagaatccacagaattttattagcagatgcctattttat
gaagtagaagtcaataacagccaaactgagacacataatgttttctacgtccaagaggct
aaatgtgagaatccagaatttgagagaaatgtggagaatacatcttgtttcatggtccct
ggtgttcttcctgatactttgaacacagtcagaataagagtcaaaacaaataagttatgc
tatgaggatgacaaactctggagtaattggagccaagaaatgagtataggtaagaagcgc
aattccacactctacataaccatgttactcattgttccagtcatcgtcgcaggtgcaatc
atagtactcctgctttacctaaaaaggctcaagattattatattccctccaattcctgat
cctggcaagatttttaaagaaatgtttggagaccagaatgatgatactctgcactggaag
aagtacgacatctatgagaagcaaaccaaggaggaaaccgactctgtagtgctgatagaa
aacctgaagaaagcctctcagtga

DBGET integrated database retrieval system