KEGG   Homo sapiens (human): 3600Help
Entry
3600              CDS       T01001                                 

Gene name
IL15, IL-15
Definition
(RefSeq) interleukin 15
  KO
K05433  interleukin 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04668  TNF signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex infection
hsa05200  Pathways in cancer
hsa05323  Rheumatoid arthritis
Network
N00053  Cytokine-Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3600 (IL15)
   04668 TNF signaling pathway
    3600 (IL15)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3600 (IL15)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    3600 (IL15)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    3600 (IL15)
  09163 Immune diseases
   05323 Rheumatoid arthritis
    3600 (IL15)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    3600 (IL15)
   05168 Herpes simplex infection
    3600 (IL15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3600 (IL15)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3600 (IL15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL15
Motif
Other DBs
NCBI-GeneID: 3600
NCBI-ProteinID: NP_000576
OMIM: 600554
HGNC: 5977
Ensembl: ENSG00000164136
Vega: OTTHUMG00000133418
Pharos: P40933(Tbio)
UniProt: P40933
Structure
PDB: 

Position
4q31.21
AA seq 162 aa AA seqDB search
MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKI
EDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANN
SLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgagaatttcgaaaccacatttgagaagtatttccatccagtgctacttgtgtttactt
ctaaacagtcattttctaactgaagctggcattcatgtcttcattttgggctgtttcagt
gcagggcttcctaaaacagaagccaactgggtgaatgtaataagtgatttgaaaaaaatt
gaagatcttattcaatctatgcatattgatgctactttatatacggaaagtgatgttcac
cccagttgcaaagtaacagcaatgaagtgctttctcttggagttacaagttatttcactt
gagtccggagatgcaagtattcatgatacagtagaaaatctgatcatcctagcaaacaac
agtttgtcttctaatgggaatgtaacagaatctggatgcaaagaatgtgaggaactggag
gaaaaaaatattaaagaatttttgcagagttttgtacatattgtccaaatgttcatcaac
acttcttga

DBGET integrated database retrieval system