KEGG   Homo sapiens (human): 3601Help
Entry
3601              CDS       T01001                                 

Gene name
IL15RA, CD215
Definition
(RefSeq) interleukin 15 receptor subunit alpha
  KO
K05074  interleukin 15 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3601 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3601 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    3601 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3601 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3601 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3601 (IL15RA)
   04090 CD molecules [BR:hsa04090]
    3601 (IL15RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3601 (IL15RA)
CD molecules [BR:hsa04090]
 Proteins
  3601 (IL15RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi
Motif
Other DBs
NCBI-GeneID: 3601
NCBI-ProteinID: NP_002180
OMIM: 601070
HGNC: 5978
Ensembl: ENSG00000134470
Vega: OTTHUMG00000017612
Pharos: Q13261(Tbio)
UniProt: Q13261
Structure
PDB: 

Position
10p15.1
AA seq 267 aa AA seqDB search
MAPRRARGCRTLGLPALLLLLLLRPPATRGITCPPPMSVEHADIWVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPE
SLSPSGKEPAASSPSSNNTAATTAAIVPGSQLMPSKSPSTGTTEISSHESSHGTPSQTTA
KNWELTASASHQPPGVYPQGHSDTTVAISTSTVLLCGLSAVSLLACYLKSRQTPPLASVE
MEAMEALPVTWGTSSRDEDLENCSHHL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcggcgggcgcgcggctgccggaccctcggtctcccggcgctgctactgctg
ctgctgctccggccgccggcgacgcggggcatcacgtgccctccccccatgtccgtggaa
cacgcagacatctgggtcaagagctacagcttgtactccagggagcggtacatttgtaac
tctggtttcaagcgtaaagccggcacgtccagcctgacggagtgcgtgttgaacaaggcc
acgaatgtcgcccactggacaacccccagtctcaaatgcattagagaccctgccctggtt
caccaaaggccagcgccaccctccacagtaacgacggcaggggtgaccccacagccagag
agcctctccccttctggaaaagagcccgcagcttcatctcccagctcaaacaacacagcg
gccacaacagcagctattgtcccgggctcccagctgatgccttcaaaatcaccttccaca
ggaaccacagagataagcagtcatgagtcctcccacggcaccccctctcagacaacagcc
aagaactgggaactcacagcatccgcctcccaccagccgccaggtgtgtatccacagggc
cacagcgacaccactgtggctatctccacgtccactgtcctgctgtgtgggctgagcgct
gtgtctctcctggcatgctacctcaagtcaaggcaaactcccccgctggccagcgttgaa
atggaagccatggaggctctgccggtgacttgggggaccagcagcagagatgaagacttg
gaaaactgctctcaccacctatga

DBGET integrated database retrieval system