KEGG   Homo sapiens (human): 3603Help
Entry
3603              CDS       T01001                                 

Gene name
IL16, LCF, NIL16, PRIL16, prIL-16
Definition
(RefSeq) interleukin 16
  KO
K22628  interleukin 16
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Disease
H01357  Allergic contact dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3603 (IL16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3603 (IL16)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3603 (IL16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ PDZ_6 PDZ_2 HP1451_C
Motif
Other DBs
NCBI-GeneID: 3603
NCBI-ProteinID: NP_757366
OMIM: 603035
HGNC: 5980
Ensembl: ENSG00000172349
Vega: OTTHUMG00000144186
Pharos: Q14005(Tbio)
UniProt: Q14005
Structure
PDB: 

Position
15q25.1
AA seq 1332 aa AA seqDB search
MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSS
VQLADTSEAGPSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEA
QSSNFLFPKACHQRARSNSTSVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQL
DCPAGKAAGTSRPTRSLSTAQLVQPSGGLQASVISNIVLMKGQAKGLGFSIVGGKDSIYG
PIGIYVKTIFAGGAAAADGRLQEGDEILELNGESMAGLTHQDALQKFKQAKKGLLTLTVR
TRLTAPPSLCSHLSPPLCRSLSSSTCITKDSSSFALESPSAPISTAKPNYRIMVEVSLQK
EAGVGLGIGLCSVPYFQCISGIFVHTLSPGSVAHLDGRLRCGDEIVEISDSPVHCLTLNE
VYTILSHCDPGPVPIIVSRHPDPQVSEQQLKEAVAQAVENTKFGKERHQWSLEGVKRLES
SWHGRPTLEKEREKNSAPPHRRAQKVMIRSSSDSSYMSGSPGGSPGSGSAEKPSSDVDIS
THSPSLPLAREPVVLSIASSRLPQESPPLPESRDSHPPLRLKKSFEILVRKPMSSKPKPP
PRKYFKSDSDPQKSLEERENSSCSSGHTPPTCGQEARELLPLLLPQEDTAGRSPSASAGC
PGPGIGPQTKSSTEGEPGWRRASPVTQTSPIKHPLLKRQARMDYSFDTTAEDPWVRISDC
IKNLFSPIMSENHGHMPLQPNASLNEEEGTQGHPDGTPPKLDTANGTPKVYKSADSSTVK
KGPPVAPKPAWFRQSLKGLRNRASDPRGLPDPALSTQPAPASREHLGSHIRASSSSSSIR
QRISSFETFGSSQLPDKGAQRLSLQPSSGEAAKPLGKHEEGRFSGLLGRGAAPTLVPQQP
EQVLSSGSPAASEARDPGVSESPPPGRQPNQKTLPPGPDPLLRLLSTQAEESQGPVLKMP
SQRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKE
GASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDGDHSSLQSGQS
VISLLSSEELKKLIEEVKVLDEATLKQLDGIHVTILHKEEGAGLGFSLAGGADLENKVIT
VHRVFPNGLASQEGTIQKGNEVLSINGKSLKGTTHHDALAILRQAREPRQAVIVTRKLTP
EAMPDLNSSTDSAASASAASDVSVESTAEATVCTVTLEKMSAGLGFSLEGGKGSLHGDKP
LTINRIFKGAASEQSETVQPGDEILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKS
LQSKETTAAGDS
NT seq 3999 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcacagccgcgctggaaagagcagaaaatctgcaaaatttcggtccatctcc
aggtccctgatgctctgtaatgctaagaccagtgatgatggctctagccctgatgagaaa
tatcctgatccctttgagatttccttggcccagggcaaggagggaattttccactcatct
gtgcagctggcagacacatcggaggctgggcccagcagtgttcctgatctagcactggcc
tcggaggctgctcaactccaagcagctgggaatgatcgaggcaagacctgtaggaggata
ttcttcatgaaggaatcttccacagcttcctctcgagaaaagcctggaaaactagaagca
caaagtagtaacttcctgtttcctaaagcctgccaccaaagggcacgcagcaactcaacc
agtgttaatccctattgcacaagagaaattgattttccaatgaccaagaaatctgcagcg
cccacggacaggcagccttactctctctgcagtaacaggaagtccctctctcaacaattg
gactgtccagcaggaaaggctgcgggaacttcgagaccaacacggtccctgagcacagct
cagctcgtgcagccatctgggggcctccaggcttcagtcatctccaacatcgtgctgatg
aagggccaggctaagggtctgggcttcagcatcgttgggggaaaagacagcatttatggc
cccattgggatttacgtcaaaaccatttttgcagggggagcagcagcagccgatggaagg
ctacaggaaggtgatgaaattctggagctcaatggtgaatcaatggctggactaacacat
caggatgctttgcagaagttcaagcaagccaaaaaggggctcctcaccctcaccgtgaga
acccgcctgacggcgcctccttccctgtgcagccacctgtctcccccactgtgccgctcc
ctgagctccagcacttgtatcaccaaggacagcagctccttcgccttggaaagcccctcg
gctcccatcagcaccgccaagcccaattacagaatcatggtggaggtttctctgcagaaa
gaggccggcgtgggcctgggcatcggcctgtgcagcgttccctacttccaatgcatctct
ggcattttcgtccacacgctgtcaccaggatccgtggcgcacctggacggacgtctccgg
tgtggggacgagattgtggaaatcagtgattcccctgtgcactgcctgacgctcaatgaa
gtctacacgatcctgagtcactgtgatcccggtccagtccccatcattgttagccgacat
ccagacccacaggtctctgaacagcaactcaaagaagctgtggcccaggctgtggaaaac
accaagtttggaaaggagaggcatcagtggagtctggaaggtgtcaaaaggctggaaagc
agttggcacgggcggcccaccttggagaaggaacgagagaagaactcagcacccccgcat
cgcagggctcagaaggtcatgatccgctccagcagtgacagcagctacatgtctgggtcc
ccagggggaagtcctgggagtggcagtgctgagaagccgtcctctgacgtggacatcagc
acacacagccccagcttgcctctggcacgggagccagtggtgctttctatagcatcctcc
aggctgccccaggagagcccacccctcccagagagccgggacagccacccgccgctgaga
ctgaagaaatcctttgagattttggtgagaaagcctatgtcctccaagcccaagcctcca
cccagaaaatactttaaaagtgacagtgaccctcagaagagtctggaagagagagagaac
tcctcatgctcttctgggcacaccccacccacctgtggccaggaagcgagagagctgctg
ccactgctgctaccacaggaagacacagcagggagaagccctagtgcctctgccggctgc
ccaggacctggtatcggcccacagaccaagtcctccacagagggcgagccagggtggaga
agagccagcccagtgacccaaacatccccgataaaacacccactgcttaagaggcaggct
cggatggactatagctttgataccacagccgaagacccttgggttaggatttctgactgc
atcaaaaacttatttagccccatcatgagtgagaaccatggccacatgcctctacagccc
aatgccagcctgaatgaagaagaagggacacagggccacccagatgggaccccaccaaag
ctggacaccgccaatggcactcccaaagtttacaagtcagcagacagcagcactgtgaag
aaaggtcctcctgtggctcccaagccagcctggtttcgccaaagcttgaaaggtttgagg
aatcgtgcttcagacccaagagggctccctgatcctgccttgtccacccagccagcacct
gcttccagggagcacctaggatcacacatccgggcctcctcctcctcctcctccatcagg
cagagaatcagctcctttgaaacctttggctcctctcaactgcctgacaaaggagcccag
agactgagcctccagccctcctctggggaggcagcaaaacctcttgggaagcatgaggaa
ggacggttttctggactcttggggcgaggggctgcacccactcttgtgccccagcagcct
gagcaagtactgtcctcggggtcccctgcagcctccgaggccagagacccaggtgtgtct
gagtcccctcccccagggcggcagcccaatcagaaaactctcccccctggcccggacccg
ctcctaaggctgctgtcaacacaggctgaggaatctcaaggcccagtgctcaagatgcct
agccagcgagcacggagcttccccctgaccaggtcccagtcctgtgagacgaagctactt
gacgaaaagaccagcaaactctattctatcagcagccaagtgtcatcggctgtcatgaaa
tccttgctgtgccttccatcttctatctcctgtgcccagactccctgcatccccaaggaa
ggggcatctccaacatcatcatccaacgaagactcagctgcaaatggttctgctgaaaca
tctgccttggacacagggttctcgctcaacctttcagagctgagagaatatacagagggt
ctcacggaagccaaggaagacgatgatggggaccacagttcccttcagtctggtcagtcc
gttatctccctgctgagctcagaagaattaaaaaaactcatcgaggaggtgaaggttctg
gatgaagcaacattaaagcaattagacggcatccatgtcaccatcttacacaaggaggaa
ggtgctggtcttgggttcagcttggcaggaggagcagatctagaaaacaaggtgattacg
gttcacagagtgtttccaaatgggctggcctcccaggaagggactattcagaagggcaat
gaggttctttccatcaacggcaagtctctcaaggggaccacgcaccatgatgccttggcc
atcctccgccaagctcgagagcccaggcaagctgtgattgtcacaaggaagctgactcca
gaggccatgcccgacctcaactcctccactgactctgcagcctcagcctctgcagccagt
gatgtttctgtagaatctacagcagaggccacagtctgcacggtgacactggagaagatg
tcggcagggctgggcttcagcctggaaggagggaagggctccctacacggagacaagcct
ctcaccattaacaggattttcaaaggagcagcctcagaacaaagtgagacagtccagcct
ggagatgaaatcttgcagctgggtggcactgccatgcagggcctcacacggtttgaagcc
tggaacatcatcaaggcactgcctgatggacctgtcacgattgtcatcaggagaaaaagc
ctccagtccaaggaaaccacagctgctggagactcctag

DBGET integrated database retrieval system