KEGG   Homo sapiens (human): 3604Help
Entry
3604              CDS       T01001                                 

Gene name
TNFRSF9, 4-1BB, CD137, CDw137, ILA
Definition
(RefSeq) TNF receptor superfamily member 9
  KO
K05146  tumor necrosis factor receptor superfamily member 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Drug target
Urelumab: D09984
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3604 (TNFRSF9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3604 (TNFRSF9)
   04090 CD molecules [BR:hsa04090]
    3604 (TNFRSF9)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   3604 (TNFRSF9)
CD molecules [BR:hsa04090]
 Proteins
  3604 (TNFRSF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Ephrin_rec_like
Motif
Other DBs
NCBI-GeneID: 3604
NCBI-ProteinID: NP_001552
OMIM: 602250
HGNC: 11924
Ensembl: ENSG00000049249
Vega: OTTHUMG00000001223
Pharos: Q07011(Tbio)
UniProt: Q07011
Structure
PDB: 

Position
1p36.23
AA seq 255 aa AA seqDB search
MGNSCYNIVATLLLVLNFERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQR
TCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDC
CFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPARE
PGHSPQIISFFLALTSTALLFLLFFLTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDG
CSCRFPEEEEGGCEL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacagctgttacaacatagtagccactctgttgctggtcctcaactttgagagg
acaagatcattgcaggatccttgtagtaactgcccagctggtacattctgtgataataac
aggaatcagatttgcagtccctgtcctccaaatagtttctccagcgcaggtggacaaagg
acctgtgacatatgcaggcagtgtaaaggtgttttcaggaccaggaaggagtgttcctcc
accagcaatgcagagtgtgactgcactccagggtttcactgcctgggggcaggatgcagc
atgtgtgaacaggattgtaaacaaggtcaagaactgacaaaaaaaggttgtaaagactgt
tgctttgggacatttaacgatcagaaacgtggcatctgtcgaccctggacaaactgttct
ttggatggaaagtctgtgcttgtgaatgggacgaaggagagggacgtggtctgtggacca
tctccagccgacctctctccgggagcatcctctgtgaccccgcctgcccctgcgagagag
ccaggacactctccgcagatcatctccttctttcttgcgctgacgtcgactgcgttgctc
ttcctgctgttcttcctcacgctccgtttctctgttgttaaacggggcagaaagaaactc
ctgtatatattcaaacaaccatttatgagaccagtacaaactactcaagaggaagatggc
tgtagctgccgatttccagaagaagaagaaggaggatgtgaactgtga

DBGET integrated database retrieval system